SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pogA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pogA
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily Homeodomain-like 3.7e-19
Family Homeodomain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pogA   PDB: 1pog   SUPERFAMILY: 1pogA
Sequence length 67
Comment (A:)
Sequence
rgshmrrrkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrq
kekridi
Download sequence
Identical sequences 1pogA cath|current|1pogA00/1-62 1pog_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]