SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1powA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1powA
Domain Number 1 Region: 360-580
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.67e-55
Family Pyruvate oxidase and decarboxylase PP module 0.00000000227
Further Details:      
 
Domain Number 2 Region: 3-174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.44e-44
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000591
Further Details:      
 
Domain Number 3 Region: 186-357
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.42e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1powA   PDB: 1pow
Sequence length 585
Comment (A:)
Sequence
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasans
yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
aiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqedtn
qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
Download sequence
Identical sequences 1powA 1pow_A 1pow_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]