SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1poxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1poxA
Domain Number 1 Region: 360-580
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.65e-55
Family Pyruvate oxidase and decarboxylase PP module 0.00000000211
Further Details:      
 
Domain Number 2 Region: 3-173
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.46e-44
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000526
Further Details:      
 
Domain Number 3 Region: 186-357
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.42e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1poxA   PDB: 1pox
Sequence length 585
Comment (A:)
Sequence
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqisaedwyasann
yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
aiaaklnyperqvfnlagdggasmtmqdlvtqvqyhlpvinvvftncqygfikdeqedtn
qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
Download sequence
Identical sequences 1poxA 1pox_A 1pox_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]