SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ps2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ps2A
Domain Number 1 Region: 4-57
Classification Level Classification E-value
Superfamily Trefoil 4.47e-19
Family Trefoil 0.0000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ps2A   PDB: 1ps2   SUPERFAMILY: 1ps2A
Sequence length 60
Comment (A:)
Sequence
eaqtetctvaprerqncgfpgvtpsqcankgccfddtvrgvpwcfypntidvppeeesef
Download sequence
Identical sequences cath|current|1ps2A00/1-60 d1ps2a_ 1ps2_A 1ps2A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]