SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pufB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pufB
Domain Number 1 Region: 8-60
Classification Level Classification E-value
Superfamily Homeodomain-like 9.63e-32
Family Homeodomain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pufB   PDB: 1puf   SUPERFAMILY: 1pufB
Sequence length 73
Comment (B:)
Sequence
arrkrrnfnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkriryk
knigkfqeeaniy
Download sequence
Identical sequences 1pufB 1puf_B 000002459|e1pufB1|101.1.1.10|B:1-73 cath|current|1pufB00/233-305 d1pufb_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]