SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1putA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1putA
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.92e-45
Family 2Fe-2S ferredoxin-related 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1putA   PDB: 1put   SUPERFAMILY: 1putA
Sequence length 106
Comment (A:)
Sequence
skvvyvshdgtrrqldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw
Download sequence
Identical sequences 1put_A 1putA 000071932|e1putA1|221.1.1.12|A:1-106 cath|current|1putA00/1-106 d1puta_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]