SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pvdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pvdA
Domain Number 1 Region: 363-541
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.93e-54
Family Pyruvate oxidase and decarboxylase PP module 0.00062
Further Details:      
 
Domain Number 2 Region: 3-182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-42
Family Pyruvate oxidase and decarboxylase Pyr module 0.01
Further Details:      
 
Domain Number 3 Region: 197-338
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.84e-42
Family Pyruvate oxidase and decarboxylase, middle domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pvdA   PDB: 1pvd
Sequence length 555
Comment (A:)
Sequence
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsissqakqlllhhtlgngd
ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll
qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
ktknivefhsdhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavpa
stplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttga
tlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytieklih
gpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieimlp
vfdapqnlvkqaklt
Download sequence
Identical sequences 1pvd_A 1pvd_B 1pvdA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]