SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pvrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pvrA
Domain Number 1 Region: 138-345
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 4.83e-41
Family Lambda integrase-like, catalytic core 0.00000000351
Further Details:      
 
Domain Number 2 Region: 27-134
Classification Level Classification E-value
Superfamily lambda integrase-like, N-terminal domain 9e-30
Family lambda integrase-like, N-terminal domain 0.000000578
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pvrA   PDB: 1pvr
Sequence length 349
Comment (A:)
Sequence
mhhhhhhsnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaa
wcklnnrkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavs
lvmrrirkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllrl
aeiarirvkdisrtdggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddp
nnylfcrvrkngvaapsatsqlsnsalggifgathrliygakddsgqrylawsghsarvg
aardmaragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
Download sequence
Identical sequences 1pvq_A 1pvq_B 1pvr_A 1pvr_B 1pvrA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]