SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1px5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1px5A
Domain Number 1 Region: 3-200
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.85e-122
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 201-343
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.42e-96
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.00000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1px5A   PDB: 1px5
Sequence length 349
Comment (A:)
Sequence
MELRHTPARDLDKFIEDHLLPNTCFRTQVKEAIDIVCRFLKERCFQGTADPVRVSKVVKG
GSSGKGTTLRGRSDADLVVFLTKLTSFEDQLRRRGEFIQEIRRQLEACQREQKFKVTFEV
QSPRRENPRALSFVLSSPQLQQEVEFDVLPAFDALGQWTPGYKPNPEIYVQLIKECKSRG
KEGEFSTCFTELQRDFLRNRPTKLKSLIRLVKHWYQTCKKTHGNKLPPQYALELLTVYAW
EQGSRKTDFSTAQGFQTVLELVLKHQKLCIFWEAYYDFTNPVVGRCMLQQLKKPRPVILD
PADPTGNVGGGDTHSWQRLAQEARVWLGYPCCKNLDGSLVGAWTMLQKI
Download sequence
Identical sequences Q29599
1px5A 1px5_A 1px5_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]