SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1q06A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1q06A
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.49e-59
Family DNA-binding N-terminal domain of transcription activators 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1q06A   PDB: 1q06   SUPERFAMILY: 1q06A
Sequence length 135
Comment (A:)
Sequence
MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNL
EESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQSMRDQLLALANACPGDDSADC
PIIENLSGCCHHRAG
Download sequence
Identical sequences A0A026UGU5 A0A027TLX5 A0A028AIJ9 A0A028DJV0 A0A062Y3Z6 A0A069XQ77 A0A070FGF7 A0A070SX01 A0A073GCN1 A0A074ITP3 A0A080G8S9 A0A0A0FAY5 A0A0A8UMH4 A0A0E0TUX6 A0A0E0Y657 A0A0E1LU52 A0A0E1STR1 A0A0E2TIH0 A0A0G3K605 A0A0I1U727 A0A0M7MVN9 A0A125X6X0 A0A127GH82 A0A140NEJ2 A0A142H034 A0A1Q8N0A0 A0A1S6T7L3 A0A1W2MW34 A0A1X3IR59 A0A1X3JLV3 A0A1X3KQB8 A0A1X3L834 A0A222QG26 A0A226K7D5 A0A236M9R4 A0A2I6QJZ4 A7ZIP7 B2U4U3 B3X030 B6I0D7 B7L7B2 B7LJG1 C8U2H3 C8UIS1 D2A8P4 D3GVC1 D6HT18 D6J7J0 D7XK35 D7Y7K4 D8E0W0 E0J6R7 E1IP96 E1J023 E3PFV2 E6BHX3 E7SMV0 E7TBN5 E9TL91 E9YYC6 F0JTM8 F3V2Y7 F4NMP6 F4SJI7 F4UZ77 F4VAS5 F5MYF1 F5NRK4 G0FCZ2 H4UFH7 I0VQL2 I2RKE0 I2S4P1 I2SYJ0 I2UQU2 I2W5L4 I2WQK7 I2XG74 I4SYF3 I6C263 I6D698 I6DTX7 I6EUC5 I6G785 I6H906 J7QJB8 J7R1G6 K0XAV8 K4V5N2 K4WUM1 L2VAN8 L4JGW8 M9H7G2 P0A9G4 P0A9G5 Q325A8 Q3Z4R0 R8XJ78 S0XAD9 S1DFD1 S1FHG1 S1HRG7 S1ITH0 S1J5Z1 T5V8Q9 T8JDD0 T9EN52 U9XNA0 U9XS35 U9ZVI4 V2QUH3 V2TJ19 V6FQR0 V8FL89 W1BEG5 W1F647 W1V6Y2 W1WUU6
gi|471332609|ref|YP_007556086.1| gi|378714108|ref|YP_005279001.1| gi|388476592|ref|YP_488778.1| gi|386703704|ref|YP_006167551.1| gi|253774523|ref|YP_003037354.1| gi|251783995|ref|YP_002998299.1| NP_415020.1.90541 NP_706380.1.23235 WP_001026747.1.1000 WP_001026747.1.100044 WP_001026747.1.100066 WP_001026747.1.100085 WP_001026747.1.100111 WP_001026747.1.100116 WP_001026747.1.100135 WP_001026747.1.100159 WP_001026747.1.100185 WP_001026747.1.100251 WP_001026747.1.100252 WP_001026747.1.100283 WP_001026747.1.100315 WP_001026747.1.10034 WP_001026747.1.100346 WP_001026747.1.100389 WP_001026747.1.100425 WP_001026747.1.100441 WP_001026747.1.100444 WP_001026747.1.100447 WP_001026747.1.100451 WP_001026747.1.100487 WP_001026747.1.100496 WP_001026747.1.100499 WP_001026747.1.10051 WP_001026747.1.100543 WP_001026747.1.100571 WP_001026747.1.100573 WP_001026747.1.100614 WP_001026747.1.100667 WP_001026747.1.10067 WP_001026747.1.10068 WP_001026747.1.100689 WP_001026747.1.100718 WP_001026747.1.100752 WP_001026747.1.100753 WP_001026747.1.100758 WP_001026747.1.100778 WP_001026747.1.100796 WP_001026747.1.10080 WP_001026747.1.100824 WP_001026747.1.100836 WP_001026747.1.100851 WP_001026747.1.100852 WP_001026747.1.10086 WP_001026747.1.100867 WP_001026747.1.100868 WP_001026747.1.100916 WP_001026747.1.100928 WP_001026747.1.100933 WP_001026747.1.10094 WP_001026747.1.100966 WP_001026747.1.100990 WP_001026747.1.101033 WP_001026747.1.101096 WP_001026747.1.101102 WP_001026747.1.101157 WP_001026747.1.101158 WP_001026747.1.101186 WP_001026747.1.101214 WP_001026747.1.101216 WP_001026747.1.101255 WP_001026747.1.101257 WP_001026747.1.10126 WP_001026747.1.101282 WP_001026747.1.101289 WP_001026747.1.101293 WP_001026747.1.101313 WP_001026747.1.101359 WP_001026747.1.101387 WP_001026747.1.101418 WP_001026747.1.101423 WP_001026747.1.101436 WP_001026747.1.101468 WP_001026747.1.101518 WP_001026747.1.101522 WP_001026747.1.10154 WP_001026747.1.101545 WP_001026747.1.101583 WP_001026747.1.101594 WP_001026747.1.101630 WP_001026747.1.101651 WP_001026747.1.101653 WP_001026747.1.101654 WP_001026747.1.101667 WP_001026747.1.101668 WP_001026747.1.101686 WP_001026747.1.10173 WP_001026747.1.101737 WP_001026747.1.101747 WP_001026747.1.101769 WP_001026747.1.101777 WP_001026747.1.101786 WP_001026747.1.101822 WP_001026747.1.10184 WP_001026747.1.101840 WP_001026747.1.101845 WP_001026747.1.101865 WP_001026747.1.10187 WP_001026747.1.10188 WP_001026747.1.101889 WP_001026747.1.10190 WP_001026747.1.101900 WP_001026747.1.101908 WP_001026747.1.101913 WP_001026747.1.101940 WP_001026747.1.101942 WP_001026747.1.101947 WP_001026747.1.101952 WP_001026747.1.101962 WP_001026747.1.101964 WP_001026747.1.101969 WP_001026747.1.101987 WP_001026747.1.102021 WP_001026747.1.102069 WP_001026747.1.102093 WP_001026747.1.102122 WP_001026747.1.10222 WP_001026747.1.10233 WP_001026747.1.10235 WP_001026747.1.10252 WP_001026747.1.10304 WP_001026747.1.10329 WP_001026747.1.10348 WP_001026747.1.10361 WP_001026747.1.10379 WP_001026747.1.10381 WP_001026747.1.1040 WP_001026747.1.10400 WP_001026747.1.10417 WP_001026747.1.10461 WP_001026747.1.10491 WP_001026747.1.10496 WP_001026747.1.10508 WP_001026747.1.10538 WP_001026747.1.10576 WP_001026747.1.10579 WP_001026747.1.1058 WP_001026747.1.10605 WP_001026747.1.10607 WP_001026747.1.10651 WP_001026747.1.10673 WP_001026747.1.1071 WP_001026747.1.10715 WP_001026747.1.10729 WP_001026747.1.1073 WP_001026747.1.1074 WP_001026747.1.10744 WP_001026747.1.10763 WP_001026747.1.10771 WP_001026747.1.10798 WP_001026747.1.10833 WP_001026747.1.10922 WP_001026747.1.10940 WP_001026747.1.10988 WP_001026747.1.10989 WP_001026747.1.10994 WP_001026747.1.10995 WP_001026747.1.11006 WP_001026747.1.11032 WP_001026747.1.11047 WP_001026747.1.11071 WP_001026747.1.11091 WP_001026747.1.11118 WP_001026747.1.11121 WP_001026747.1.1113 WP_001026747.1.1122 WP_001026747.1.11241 WP_001026747.1.11265 WP_001026747.1.11296 WP_001026747.1.11323 WP_001026747.1.11408 WP_001026747.1.11418 WP_001026747.1.11436 WP_001026747.1.11437 WP_001026747.1.11440 WP_001026747.1.11452 WP_001026747.1.11524 WP_001026747.1.11578 WP_001026747.1.11595 WP_001026747.1.11616 WP_001026747.1.11645 WP_001026747.1.11673 WP_001026747.1.1168 WP_001026747.1.11699 WP_001026747.1.11748 WP_001026747.1.11759 WP_001026747.1.1176 WP_001026747.1.11762 WP_001026747.1.11801 WP_001026747.1.11803 WP_001026747.1.11844 WP_001026747.1.1186 WP_001026747.1.11912 WP_001026747.1.11949 WP_001026747.1.11955 WP_001026747.1.11956 WP_001026747.1.1196 WP_001026747.1.11982 WP_001026747.1.11985 WP_001026747.1.12000 WP_001026747.1.12030 WP_001026747.1.12036 WP_001026747.1.12051 WP_001026747.1.12060 WP_001026747.1.12112 WP_001026747.1.1212 WP_001026747.1.1218 WP_001026747.1.12204 WP_001026747.1.12279 WP_001026747.1.12319 WP_001026747.1.12320 WP_001026747.1.12342 WP_001026747.1.12344 WP_001026747.1.12415 WP_001026747.1.1242 WP_001026747.1.12426 WP_001026747.1.12458 WP_001026747.1.12459 WP_001026747.1.12468 WP_001026747.1.12478 WP_001026747.1.12542 WP_001026747.1.12558 WP_001026747.1.12566 WP_001026747.1.12582 WP_001026747.1.12594 WP_001026747.1.12623 WP_001026747.1.12645 WP_001026747.1.12675 WP_001026747.1.12680 WP_001026747.1.12693 WP_001026747.1.127 WP_001026747.1.12717 WP_001026747.1.12743 WP_001026747.1.12749 WP_001026747.1.1275 WP_001026747.1.12756 WP_001026747.1.12762 WP_001026747.1.12775 WP_001026747.1.12781 WP_001026747.1.1280 WP_001026747.1.12831 WP_001026747.1.12876 WP_001026747.1.12911 WP_001026747.1.12914 WP_001026747.1.12944 WP_001026747.1.1295 WP_001026747.1.12965 WP_001026747.1.12979 WP_001026747.1.12987 WP_001026747.1.13002 WP_001026747.1.13015 WP_001026747.1.13031 WP_001026747.1.13074 WP_001026747.1.1312 WP_001026747.1.13136 WP_001026747.1.13144 WP_001026747.1.1315 WP_001026747.1.13157 WP_001026747.1.13162 WP_001026747.1.13176 WP_001026747.1.13222 WP_001026747.1.13239 WP_001026747.1.13252 WP_001026747.1.13258 WP_001026747.1.13278 WP_001026747.1.13281 WP_001026747.1.13290 WP_001026747.1.13301 WP_001026747.1.13333 WP_001026747.1.13346 WP_001026747.1.1335 WP_001026747.1.13411 WP_001026747.1.13437 WP_001026747.1.1345 WP_001026747.1.13451 WP_001026747.1.13469 WP_001026747.1.13473 WP_001026747.1.13495 WP_001026747.1.13525 WP_001026747.1.13585 WP_001026747.1.13600 WP_001026747.1.13608 WP_001026747.1.13618 WP_001026747.1.13624 WP_001026747.1.13644 WP_001026747.1.13656 WP_001026747.1.13664 WP_001026747.1.13791 WP_001026747.1.13798 WP_001026747.1.13824 WP_001026747.1.13867 WP_001026747.1.13877 WP_001026747.1.13891 WP_001026747.1.13924 WP_001026747.1.13944 WP_001026747.1.13949 WP_001026747.1.13974 WP_001026747.1.14030 WP_001026747.1.14058 WP_001026747.1.14070 WP_001026747.1.14094 WP_001026747.1.14127 WP_001026747.1.14129 WP_001026747.1.14154 WP_001026747.1.1419 WP_001026747.1.14199 WP_001026747.1.142 WP_001026747.1.14253 WP_001026747.1.14277 WP_001026747.1.14292 WP_001026747.1.14304 WP_001026747.1.14346 WP_001026747.1.1438 WP_001026747.1.1439 WP_001026747.1.14398 WP_001026747.1.14417 WP_001026747.1.14432 WP_001026747.1.14451 WP_001026747.1.14468 WP_001026747.1.14493 WP_001026747.1.14499 WP_001026747.1.14501 WP_001026747.1.14508 WP_001026747.1.14529 WP_001026747.1.14536 WP_001026747.1.14582 WP_001026747.1.14600 WP_001026747.1.14601 WP_001026747.1.1461 WP_001026747.1.14616 WP_001026747.1.14672 WP_001026747.1.14678 WP_001026747.1.14693 WP_001026747.1.1470 WP_001026747.1.14711 WP_001026747.1.14811 WP_001026747.1.14833 WP_001026747.1.1486 WP_001026747.1.14871 WP_001026747.1.14879 WP_001026747.1.14956 WP_001026747.1.14958 WP_001026747.1.14965 WP_001026747.1.14977 WP_001026747.1.14992 WP_001026747.1.14993 WP_001026747.1.15007 WP_001026747.1.15041 WP_001026747.1.1508 WP_001026747.1.15087 WP_001026747.1.1510 WP_001026747.1.15117 WP_001026747.1.1512 WP_001026747.1.15121 WP_001026747.1.15138 WP_001026747.1.15177 WP_001026747.1.15193 WP_001026747.1.15207 WP_001026747.1.15221 WP_001026747.1.1524 WP_001026747.1.15245 WP_001026747.1.15252 WP_001026747.1.15259 WP_001026747.1.15270 WP_001026747.1.15277 WP_001026747.1.15282 WP_001026747.1.15287 WP_001026747.1.153 WP_001026747.1.15300 WP_001026747.1.15332 WP_001026747.1.15335 WP_001026747.1.15377 WP_001026747.1.15416 WP_001026747.1.1543 WP_001026747.1.15444 WP_001026747.1.15464 WP_001026747.1.15469 WP_001026747.1.15496 WP_001026747.1.1550 WP_001026747.1.15521 WP_001026747.1.15528 WP_001026747.1.15538 WP_001026747.1.15576 WP_001026747.1.15583 WP_001026747.1.15593 WP_001026747.1.15600 WP_001026747.1.1561 WP_001026747.1.15620 WP_001026747.1.15645 WP_001026747.1.15707 WP_001026747.1.15740 WP_001026747.1.15747 WP_001026747.1.15752 WP_001026747.1.15762 WP_001026747.1.15767 WP_001026747.1.15768 WP_001026747.1.15791 WP_001026747.1.15809 WP_001026747.1.1582 WP_001026747.1.1588 WP_001026747.1.15894 WP_001026747.1.15916 WP_001026747.1.15945 WP_001026747.1.15949 WP_001026747.1.15983 WP_001026747.1.16014 WP_001026747.1.16042 WP_001026747.1.16086 WP_001026747.1.16087 WP_001026747.1.1609 WP_001026747.1.16102 WP_001026747.1.16111 WP_001026747.1.16154 WP_001026747.1.16171 WP_001026747.1.16179 WP_001026747.1.16183 WP_001026747.1.16194 WP_001026747.1.1621 WP_001026747.1.16294 WP_001026747.1.1634 WP_001026747.1.16387 WP_001026747.1.16388 WP_001026747.1.1640 WP_001026747.1.16435 WP_001026747.1.16482 WP_001026747.1.16500 WP_001026747.1.16517 WP_001026747.1.16532 WP_001026747.1.16539 WP_001026747.1.16541 WP_001026747.1.1655 WP_001026747.1.16577 WP_001026747.1.16592 WP_001026747.1.16604 WP_001026747.1.16612 WP_001026747.1.16648 WP_001026747.1.16667 WP_001026747.1.16669 WP_001026747.1.16682 WP_001026747.1.16700 WP_001026747.1.16715 WP_001026747.1.16721 WP_001026747.1.1673 WP_001026747.1.16745 WP_001026747.1.16752 WP_001026747.1.16805 WP_001026747.1.16861 WP_001026747.1.16862 WP_001026747.1.16894 WP_001026747.1.16992 WP_001026747.1.17018 WP_001026747.1.17061 WP_001026747.1.17084 WP_001026747.1.17085 WP_001026747.1.17087 WP_001026747.1.1710 WP_001026747.1.17101 WP_001026747.1.17102 WP_001026747.1.17109 WP_001026747.1.17111 WP_001026747.1.17114 WP_001026747.1.17119 WP_001026747.1.17123 WP_001026747.1.17150 WP_001026747.1.17170 WP_001026747.1.17172 WP_001026747.1.17182 WP_001026747.1.17186 WP_001026747.1.17205 WP_001026747.1.17216 WP_001026747.1.17230 WP_001026747.1.17241 WP_001026747.1.17242 WP_001026747.1.1726 WP_001026747.1.17267 WP_001026747.1.17282 WP_001026747.1.17290 WP_001026747.1.17297 WP_001026747.1.17301 WP_001026747.1.17356 WP_001026747.1.17360 WP_001026747.1.17373 WP_001026747.1.17389 WP_001026747.1.17392 WP_001026747.1.17403 WP_001026747.1.17410 WP_001026747.1.17417 WP_001026747.1.17441 WP_001026747.1.17464 WP_001026747.1.17496 WP_001026747.1.17534 WP_001026747.1.1754 WP_001026747.1.1755 WP_001026747.1.17550 WP_001026747.1.17570 WP_001026747.1.17577 WP_001026747.1.17595 WP_001026747.1.17623 WP_001026747.1.1763 WP_001026747.1.17637 WP_001026747.1.1766 WP_001026747.1.1769 WP_001026747.1.17701 WP_001026747.1.17711 WP_001026747.1.17734 WP_001026747.1.17766 WP_001026747.1.1778 WP_001026747.1.17802 WP_001026747.1.17829 WP_001026747.1.17831 WP_001026747.1.17836 WP_001026747.1.17889 WP_001026747.1.17920 WP_001026747.1.17952 WP_001026747.1.17961 WP_001026747.1.17963 WP_001026747.1.17984 WP_001026747.1.18000 WP_001026747.1.18006 WP_001026747.1.18050 WP_001026747.1.18064 WP_001026747.1.18094 WP_001026747.1.18133 WP_001026747.1.18134 WP_001026747.1.18141 WP_001026747.1.18164 WP_001026747.1.18175 WP_001026747.1.18225 WP_001026747.1.18226 WP_001026747.1.18229 WP_001026747.1.18311 WP_001026747.1.18329 WP_001026747.1.18338 WP_001026747.1.18381 WP_001026747.1.18402 WP_001026747.1.18410 WP_001026747.1.18436 WP_001026747.1.18438 WP_001026747.1.1844 WP_001026747.1.18458 WP_001026747.1.18472 WP_001026747.1.18482 WP_001026747.1.18519 WP_001026747.1.18530 WP_001026747.1.18588 WP_001026747.1.18649 WP_001026747.1.18650 WP_001026747.1.18655 WP_001026747.1.1866 WP_001026747.1.18666 WP_001026747.1.1867 WP_001026747.1.18675 WP_001026747.1.18699 WP_001026747.1.18714 WP_001026747.1.18726 WP_001026747.1.18794 WP_001026747.1.188 WP_001026747.1.18858 WP_001026747.1.18861 WP_001026747.1.18874 WP_001026747.1.18876 WP_001026747.1.18899 WP_001026747.1.18923 WP_001026747.1.18936 WP_001026747.1.18983 WP_001026747.1.19024 WP_001026747.1.1903 WP_001026747.1.1906 WP_001026747.1.19075 WP_001026747.1.1909 WP_001026747.1.19100 WP_001026747.1.19114 WP_001026747.1.19129 WP_001026747.1.19147 WP_001026747.1.19148 WP_001026747.1.1915 WP_001026747.1.19150 WP_001026747.1.19194 WP_001026747.1.19205 WP_001026747.1.19206 WP_001026747.1.1925 WP_001026747.1.19277 WP_001026747.1.19297 WP_001026747.1.193 WP_001026747.1.19312 WP_001026747.1.19313 WP_001026747.1.19314 WP_001026747.1.19315 WP_001026747.1.19332 WP_001026747.1.19347 WP_001026747.1.19361 WP_001026747.1.19389 WP_001026747.1.19397 WP_001026747.1.19424 WP_001026747.1.19441 WP_001026747.1.19448 WP_001026747.1.19453 WP_001026747.1.19478 WP_001026747.1.19487 WP_001026747.1.19494 WP_001026747.1.19544 WP_001026747.1.19557 WP_001026747.1.19581 WP_001026747.1.19583 WP_001026747.1.19602 WP_001026747.1.1963 WP_001026747.1.19644 WP_001026747.1.19649 WP_001026747.1.19651 WP_001026747.1.19655 WP_001026747.1.19684 WP_001026747.1.19691 WP_001026747.1.19758 WP_001026747.1.19778 WP_001026747.1.19795 WP_001026747.1.1982 WP_001026747.1.19838 WP_001026747.1.19845 WP_001026747.1.19861 WP_001026747.1.19878 WP_001026747.1.19889 WP_001026747.1.19940 WP_001026747.1.19994 WP_001026747.1.20025 WP_001026747.1.20114 WP_001026747.1.20129 WP_001026747.1.20133 WP_001026747.1.20136 WP_001026747.1.2015 WP_001026747.1.20151 WP_001026747.1.20157 WP_001026747.1.20159 WP_001026747.1.20164 WP_001026747.1.20166 WP_001026747.1.20170 WP_001026747.1.20178 WP_001026747.1.20183 WP_001026747.1.20215 WP_001026747.1.20251 WP_001026747.1.20277 WP_001026747.1.20308 WP_001026747.1.20318 WP_001026747.1.20325 WP_001026747.1.20331 WP_001026747.1.20334 WP_001026747.1.20370 WP_001026747.1.20445 WP_001026747.1.20483 WP_001026747.1.20484 WP_001026747.1.20506 WP_001026747.1.20515 WP_001026747.1.20519 WP_001026747.1.20536 WP_001026747.1.20549 WP_001026747.1.20596 WP_001026747.1.2063 WP_001026747.1.20630 WP_001026747.1.20638 WP_001026747.1.20662 WP_001026747.1.20691 WP_001026747.1.20724 WP_001026747.1.20730 WP_001026747.1.20737 WP_001026747.1.20785 WP_001026747.1.20813 WP_001026747.1.20824 WP_001026747.1.20848 WP_001026747.1.20907 WP_001026747.1.2093 WP_001026747.1.2094 WP_001026747.1.20943 WP_001026747.1.20958 WP_001026747.1.20982 WP_001026747.1.2100 WP_001026747.1.21017 WP_001026747.1.21020 WP_001026747.1.21024 WP_001026747.1.21029 WP_001026747.1.21033 WP_001026747.1.21041 WP_001026747.1.21057 WP_001026747.1.21104 WP_001026747.1.21122 WP_001026747.1.21129 WP_001026747.1.21131 WP_001026747.1.21137 WP_001026747.1.21171 WP_001026747.1.21248 WP_001026747.1.21251 WP_001026747.1.21277 WP_001026747.1.21320 WP_001026747.1.21336 WP_001026747.1.2142 WP_001026747.1.21441 WP_001026747.1.21450 WP_001026747.1.21470 WP_001026747.1.21519 WP_001026747.1.2156 WP_001026747.1.21573 WP_001026747.1.21578 WP_001026747.1.21596 WP_001026747.1.21628 WP_001026747.1.21637 WP_001026747.1.2164 WP_001026747.1.21656 WP_001026747.1.21661 WP_001026747.1.21667 WP_001026747.1.21673 WP_001026747.1.21696 WP_001026747.1.21732 WP_001026747.1.21733 WP_001026747.1.21758 WP_001026747.1.21771 WP_001026747.1.21812 WP_001026747.1.21823 WP_001026747.1.21887 WP_001026747.1.21895 WP_001026747.1.21915 WP_001026747.1.21945 WP_001026747.1.21948 WP_001026747.1.21986 WP_001026747.1.21992 WP_001026747.1.22060 WP_001026747.1.22113 WP_001026747.1.22138 WP_001026747.1.22195 WP_001026747.1.22204 WP_001026747.1.22269 WP_001026747.1.22291 WP_001026747.1.22295 WP_001026747.1.22314 WP_001026747.1.22325 WP_001026747.1.22328 WP_001026747.1.22350 WP_001026747.1.22359 WP_001026747.1.22409 WP_001026747.1.22431 WP_001026747.1.22450 WP_001026747.1.22470 WP_001026747.1.22494 WP_001026747.1.22522 WP_001026747.1.22544 WP_001026747.1.22571 WP_001026747.1.22572 WP_001026747.1.22574 WP_001026747.1.22579 WP_001026747.1.22599 WP_001026747.1.22602 WP_001026747.1.22631 WP_001026747.1.22632 WP_001026747.1.22649 WP_001026747.1.22662 WP_001026747.1.22669 WP_001026747.1.22685 WP_001026747.1.22690 WP_001026747.1.22691 WP_001026747.1.22756 WP_001026747.1.22765 WP_001026747.1.22771 WP_001026747.1.22777 WP_001026747.1.22783 WP_001026747.1.22827 WP_001026747.1.22830 WP_001026747.1.22846 WP_001026747.1.22868 WP_001026747.1.22875 WP_001026747.1.22878 WP_001026747.1.22885 WP_001026747.1.22896 WP_001026747.1.22908 WP_001026747.1.22961 WP_001026747.1.2300 WP_001026747.1.23005 WP_001026747.1.23026 WP_001026747.1.23035 WP_001026747.1.23042 WP_001026747.1.23044 WP_001026747.1.23045 WP_001026747.1.23062 WP_001026747.1.23078 WP_001026747.1.23090 WP_001026747.1.23092 WP_001026747.1.23105 WP_001026747.1.23135 WP_001026747.1.2325 WP_001026747.1.23257 WP_001026747.1.23285 WP_001026747.1.23290 WP_001026747.1.23293 WP_001026747.1.23351 WP_001026747.1.23352 WP_001026747.1.23376 WP_001026747.1.23378 WP_001026747.1.23383 WP_001026747.1.23388 WP_001026747.1.23393 WP_001026747.1.23463 WP_001026747.1.23486 WP_001026747.1.23487 WP_001026747.1.23511 WP_001026747.1.23520 WP_001026747.1.23527 WP_001026747.1.23549 WP_001026747.1.23593 WP_001026747.1.2362 WP_001026747.1.23622 WP_001026747.1.23625 WP_001026747.1.23640 WP_001026747.1.23676 WP_001026747.1.23693 WP_001026747.1.23741 WP_001026747.1.23754 WP_001026747.1.23765 WP_001026747.1.23795 WP_001026747.1.23812 WP_001026747.1.23881 WP_001026747.1.23886 WP_001026747.1.23898 WP_001026747.1.23914 WP_001026747.1.23915 WP_001026747.1.23945 WP_001026747.1.2395 WP_001026747.1.23950 WP_001026747.1.23960 WP_001026747.1.23970 WP_001026747.1.24024 WP_001026747.1.24045 WP_001026747.1.24068 WP_001026747.1.24089 WP_001026747.1.24122 WP_001026747.1.24124 WP_001026747.1.24136 WP_001026747.1.24170 WP_001026747.1.2418 WP_001026747.1.24194 WP_001026747.1.24233 WP_001026747.1.24278 WP_001026747.1.2428 WP_001026747.1.2430 WP_001026747.1.24304 WP_001026747.1.24316 WP_001026747.1.2433 WP_001026747.1.24362 WP_001026747.1.24374 WP_001026747.1.24381 WP_001026747.1.24383 WP_001026747.1.24460 WP_001026747.1.24473 WP_001026747.1.24483 WP_001026747.1.24485 WP_001026747.1.24499 WP_001026747.1.24536 WP_001026747.1.24547 WP_001026747.1.2456 WP_001026747.1.24560 WP_001026747.1.24575 WP_001026747.1.24583 WP_001026747.1.24592 WP_001026747.1.24616 WP_001026747.1.24642 WP_001026747.1.24646 WP_001026747.1.24650 WP_001026747.1.24693 WP_001026747.1.24783 WP_001026747.1.2479 WP_001026747.1.24791 WP_001026747.1.24799 WP_001026747.1.24849 WP_001026747.1.24876 WP_001026747.1.24899 WP_001026747.1.24929 WP_001026747.1.24939 WP_001026747.1.24946 WP_001026747.1.24960 WP_001026747.1.24982 WP_001026747.1.24984 WP_001026747.1.25019 WP_001026747.1.25038 WP_001026747.1.25039 WP_001026747.1.2504 WP_001026747.1.25042 WP_001026747.1.25050 WP_001026747.1.25060 WP_001026747.1.25085 WP_001026747.1.25086 WP_001026747.1.25087 WP_001026747.1.25126 WP_001026747.1.25141 WP_001026747.1.25183 WP_001026747.1.25193 WP_001026747.1.25203 WP_001026747.1.25289 WP_001026747.1.2531 WP_001026747.1.25312 WP_001026747.1.25324 WP_001026747.1.2537 WP_001026747.1.25378 WP_001026747.1.25403 WP_001026747.1.25414 WP_001026747.1.2543 WP_001026747.1.255 WP_001026747.1.25517 WP_001026747.1.25525 WP_001026747.1.25548 WP_001026747.1.2558 WP_001026747.1.25592 WP_001026747.1.25602 WP_001026747.1.25613 WP_001026747.1.25631 WP_001026747.1.25643 WP_001026747.1.25652 WP_001026747.1.25713 WP_001026747.1.25718 WP_001026747.1.25726 WP_001026747.1.25755 WP_001026747.1.25799 WP_001026747.1.25832 WP_001026747.1.25843 WP_001026747.1.25855 WP_001026747.1.25886 WP_001026747.1.25945 WP_001026747.1.25996 WP_001026747.1.26005 WP_001026747.1.26048 WP_001026747.1.26055 WP_001026747.1.26061 WP_001026747.1.26100 WP_001026747.1.2612 WP_001026747.1.26125 WP_001026747.1.26130 WP_001026747.1.26135 WP_001026747.1.26150 WP_001026747.1.26161 WP_001026747.1.26186 WP_001026747.1.26191 WP_001026747.1.26264 WP_001026747.1.26270 WP_001026747.1.26325 WP_001026747.1.26331 WP_001026747.1.2637 WP_001026747.1.26379 WP_001026747.1.26391 WP_001026747.1.26401 WP_001026747.1.26403 WP_001026747.1.26419 WP_001026747.1.2642 WP_001026747.1.26443 WP_001026747.1.26467 WP_001026747.1.26479 WP_001026747.1.26480 WP_001026747.1.26517 WP_001026747.1.26569 WP_001026747.1.26575 WP_001026747.1.26588 WP_001026747.1.26598 WP_001026747.1.26609 WP_001026747.1.26613 WP_001026747.1.26644 WP_001026747.1.2665 WP_001026747.1.26658 WP_001026747.1.26683 WP_001026747.1.26716 WP_001026747.1.26720 WP_001026747.1.26736 WP_001026747.1.26912 WP_001026747.1.26941 WP_001026747.1.26943 WP_001026747.1.27019 WP_001026747.1.27057 WP_001026747.1.27060 WP_001026747.1.27098 WP_001026747.1.27101 WP_001026747.1.2712 WP_001026747.1.27134 WP_001026747.1.27141 WP_001026747.1.27148 WP_001026747.1.27175 WP_001026747.1.27214 WP_001026747.1.27234 WP_001026747.1.27260 WP_001026747.1.27280 WP_001026747.1.27283 WP_001026747.1.27287 WP_001026747.1.27292 WP_001026747.1.2731 WP_001026747.1.27310 WP_001026747.1.27330 WP_001026747.1.27367 WP_001026747.1.27373 WP_001026747.1.27424 WP_001026747.1.27426 WP_001026747.1.27451 WP_001026747.1.27472 WP_001026747.1.27504 WP_001026747.1.27524 WP_001026747.1.2755 WP_001026747.1.27560 WP_001026747.1.27580 WP_001026747.1.27611 WP_001026747.1.27683 WP_001026747.1.27691 WP_001026747.1.27698 WP_001026747.1.27723 WP_001026747.1.27734 WP_001026747.1.27741 WP_001026747.1.27742 WP_001026747.1.27749 WP_001026747.1.27758 WP_001026747.1.27774 WP_001026747.1.27786 WP_001026747.1.2782 WP_001026747.1.27856 WP_001026747.1.27876 WP_001026747.1.27879 WP_001026747.1.27897 WP_001026747.1.27923 WP_001026747.1.27971 WP_001026747.1.28046 WP_001026747.1.28109 WP_001026747.1.2811 WP_001026747.1.28110 WP_001026747.1.28128 WP_001026747.1.2823 WP_001026747.1.28250 WP_001026747.1.2826 WP_001026747.1.28268 WP_001026747.1.28271 WP_001026747.1.28305 WP_001026747.1.28371 WP_001026747.1.28401 WP_001026747.1.28414 WP_001026747.1.28440 WP_001026747.1.28480 WP_001026747.1.28491 WP_001026747.1.28496 WP_001026747.1.28509 WP_001026747.1.28523 WP_001026747.1.28536 WP_001026747.1.28540 WP_001026747.1.28544 WP_001026747.1.28554 WP_001026747.1.28662 WP_001026747.1.28683 WP_001026747.1.28697 WP_001026747.1.28711 WP_001026747.1.28760 WP_001026747.1.28762 WP_001026747.1.28769 WP_001026747.1.28809 WP_001026747.1.2881 WP_001026747.1.28835 WP_001026747.1.28919 WP_001026747.1.28950 WP_001026747.1.28953 WP_001026747.1.28982 WP_001026747.1.28994 WP_001026747.1.290 WP_001026747.1.29001 WP_001026747.1.29013 WP_001026747.1.29016 WP_001026747.1.29026 WP_001026747.1.29049 WP_001026747.1.29055 WP_001026747.1.29061 WP_001026747.1.29079 WP_001026747.1.29082 WP_001026747.1.29100 WP_001026747.1.29118 WP_001026747.1.29128 WP_001026747.1.29150 WP_001026747.1.29176 WP_001026747.1.29194 WP_001026747.1.29197 WP_001026747.1.29202 WP_001026747.1.29206 WP_001026747.1.29221 WP_001026747.1.29230 WP_001026747.1.29252 WP_001026747.1.2926 WP_001026747.1.2931 WP_001026747.1.29394 WP_001026747.1.2942 WP_001026747.1.2945 WP_001026747.1.29495 WP_001026747.1.29503 WP_001026747.1.29504 WP_001026747.1.2952 WP_001026747.1.2954 WP_001026747.1.29643 WP_001026747.1.29669 WP_001026747.1.29683 WP_001026747.1.29689 WP_001026747.1.29699 WP_001026747.1.29715 WP_001026747.1.29740 WP_001026747.1.29746 WP_001026747.1.29752 WP_001026747.1.29798 WP_001026747.1.29812 WP_001026747.1.29821 WP_001026747.1.29840 WP_001026747.1.2986 WP_001026747.1.29874 WP_001026747.1.29876 WP_001026747.1.29884 WP_001026747.1.2995 WP_001026747.1.29967 WP_001026747.1.29992 WP_001026747.1.30004 WP_001026747.1.30016 WP_001026747.1.30035 WP_001026747.1.30098 WP_001026747.1.30105 WP_001026747.1.30123 WP_001026747.1.30221 WP_001026747.1.30231 WP_001026747.1.30247 WP_001026747.1.30253 WP_001026747.1.30391 WP_001026747.1.30399 WP_001026747.1.30428 WP_001026747.1.3045 WP_001026747.1.30452 WP_001026747.1.30472 WP_001026747.1.30479 WP_001026747.1.30497 WP_001026747.1.30546 WP_001026747.1.30554 WP_001026747.1.30580 WP_001026747.1.3063 WP_001026747.1.30630 WP_001026747.1.30639 WP_001026747.1.30640 WP_001026747.1.30733 WP_001026747.1.30742 WP_001026747.1.30749 WP_001026747.1.30783 WP_001026747.1.30808 WP_001026747.1.30843 WP_001026747.1.30853 WP_001026747.1.30866 WP_001026747.1.30906 WP_001026747.1.30987 WP_001026747.1.31000 WP_001026747.1.31009 WP_001026747.1.31083 WP_001026747.1.31089 WP_001026747.1.31142 WP_001026747.1.31211 WP_001026747.1.31295 WP_001026747.1.31319 WP_001026747.1.31340 WP_001026747.1.31347 WP_001026747.1.31357 WP_001026747.1.31379 WP_001026747.1.31407 WP_001026747.1.31419 WP_001026747.1.31421 WP_001026747.1.31429 WP_001026747.1.31431 WP_001026747.1.31482 WP_001026747.1.31506 WP_001026747.1.31509 WP_001026747.1.31518 WP_001026747.1.31521 WP_001026747.1.31527 WP_001026747.1.31614 WP_001026747.1.31618 WP_001026747.1.31639 WP_001026747.1.31679 WP_001026747.1.3169 WP_001026747.1.31709 WP_001026747.1.31740 WP_001026747.1.3176 WP_001026747.1.31801 WP_001026747.1.3181 WP_001026747.1.31833 WP_001026747.1.31835 WP_001026747.1.31839 WP_001026747.1.31860 WP_001026747.1.31866 WP_001026747.1.31898 WP_001026747.1.31899 WP_001026747.1.31924 WP_001026747.1.31928 WP_001026747.1.3193 WP_001026747.1.31978 WP_001026747.1.32020 WP_001026747.1.32037 WP_001026747.1.32078 WP_001026747.1.32089 WP_001026747.1.32091 WP_001026747.1.32093 WP_001026747.1.32094 WP_001026747.1.3212 WP_001026747.1.32121 WP_001026747.1.32127 WP_001026747.1.32138 WP_001026747.1.32142 WP_001026747.1.32143 WP_001026747.1.3215 WP_001026747.1.32173 WP_001026747.1.32184 WP_001026747.1.32232 WP_001026747.1.32234 WP_001026747.1.32236 WP_001026747.1.32279 WP_001026747.1.32287 WP_001026747.1.32333 WP_001026747.1.32394 WP_001026747.1.32406 WP_001026747.1.32435 WP_001026747.1.32443 WP_001026747.1.3247 WP_001026747.1.32475 WP_001026747.1.32479 WP_001026747.1.3248 WP_001026747.1.32480 WP_001026747.1.32494 WP_001026747.1.32509 WP_001026747.1.32561 WP_001026747.1.32580 WP_001026747.1.32591 WP_001026747.1.32635 WP_001026747.1.32655 WP_001026747.1.32661 WP_001026747.1.32676 WP_001026747.1.32680 WP_001026747.1.327 WP_001026747.1.32709 WP_001026747.1.32720 WP_001026747.1.32722 WP_001026747.1.32724 WP_001026747.1.32741 WP_001026747.1.32772 WP_001026747.1.32811 WP_001026747.1.32815 WP_001026747.1.32831 WP_001026747.1.32835 WP_001026747.1.32875 WP_001026747.1.32903 WP_001026747.1.32910 WP_001026747.1.32946 WP_001026747.1.32959 WP_001026747.1.32972 WP_001026747.1.32984 WP_001026747.1.32992 WP_001026747.1.32995 WP_001026747.1.33004 WP_001026747.1.33014 WP_001026747.1.33018 WP_001026747.1.33022 WP_001026747.1.33053 WP_001026747.1.33119 WP_001026747.1.33171 WP_001026747.1.3323 WP_001026747.1.33237 WP_001026747.1.33238 WP_001026747.1.33244 WP_001026747.1.33325 WP_001026747.1.33341 WP_001026747.1.33362 WP_001026747.1.33385 WP_001026747.1.334 WP_001026747.1.33408 WP_001026747.1.33422 WP_001026747.1.33424 WP_001026747.1.33428 WP_001026747.1.33475 WP_001026747.1.33502 WP_001026747.1.33512 WP_001026747.1.33526 WP_001026747.1.3354 WP_001026747.1.33545 WP_001026747.1.33561 WP_001026747.1.33565 WP_001026747.1.33595 WP_001026747.1.33631 WP_001026747.1.33638 WP_001026747.1.33648 WP_001026747.1.33667 WP_001026747.1.33680 WP_001026747.1.33729 WP_001026747.1.33736 WP_001026747.1.33745 WP_001026747.1.33746 WP_001026747.1.33751 WP_001026747.1.33799 WP_001026747.1.33823 WP_001026747.1.33853 WP_001026747.1.33854 WP_001026747.1.33879 WP_001026747.1.33888 WP_001026747.1.33896 WP_001026747.1.33914 WP_001026747.1.33952 WP_001026747.1.33974 WP_001026747.1.33979 WP_001026747.1.3398 WP_001026747.1.3401 WP_001026747.1.34032 WP_001026747.1.34094 WP_001026747.1.3411 WP_001026747.1.34122 WP_001026747.1.34124 WP_001026747.1.3415 WP_001026747.1.342 WP_001026747.1.34206 WP_001026747.1.34273 WP_001026747.1.34332 WP_001026747.1.34341 WP_001026747.1.34363 WP_001026747.1.34380 WP_001026747.1.34397 WP_001026747.1.3444 WP_001026747.1.34440 WP_001026747.1.34444 WP_001026747.1.34464 WP_001026747.1.34525 WP_001026747.1.34532 WP_001026747.1.34538 WP_001026747.1.34541 WP_001026747.1.34557 WP_001026747.1.34605 WP_001026747.1.34668 WP_001026747.1.347 WP_001026747.1.34727 WP_001026747.1.34781 WP_001026747.1.34782 WP_001026747.1.34794 WP_001026747.1.34827 WP_001026747.1.34855 WP_001026747.1.34948 WP_001026747.1.34982 WP_001026747.1.34990 WP_001026747.1.34993 WP_001026747.1.35006 WP_001026747.1.35012 WP_001026747.1.35039 WP_001026747.1.35114 WP_001026747.1.35180 WP_001026747.1.35186 WP_001026747.1.35195 WP_001026747.1.35202 WP_001026747.1.35204 WP_001026747.1.3521 WP_001026747.1.35211 WP_001026747.1.35316 WP_001026747.1.35360 WP_001026747.1.35365 WP_001026747.1.35368 WP_001026747.1.35376 WP_001026747.1.3539 WP_001026747.1.35398 WP_001026747.1.35464 WP_001026747.1.35465 WP_001026747.1.35466 WP_001026747.1.35468 WP_001026747.1.35552 WP_001026747.1.35581 WP_001026747.1.3560 WP_001026747.1.35604 WP_001026747.1.35649 WP_001026747.1.35651 WP_001026747.1.35653 WP_001026747.1.35704 WP_001026747.1.35724 WP_001026747.1.35740 WP_001026747.1.35744 WP_001026747.1.35904 WP_001026747.1.35922 WP_001026747.1.35927 WP_001026747.1.35934 WP_001026747.1.35942 WP_001026747.1.35959 WP_001026747.1.3598 WP_001026747.1.35983 WP_001026747.1.36040 WP_001026747.1.36042 WP_001026747.1.36070 WP_001026747.1.36071 WP_001026747.1.36085 WP_001026747.1.36094 WP_001026747.1.36129 WP_001026747.1.36159 WP_001026747.1.36164 WP_001026747.1.36166 WP_001026747.1.36177 WP_001026747.1.36182 WP_001026747.1.3620 WP_001026747.1.36281 WP_001026747.1.36299 WP_001026747.1.36332 WP_001026747.1.36334 WP_001026747.1.36393 WP_001026747.1.36412 WP_001026747.1.36426 WP_001026747.1.36453 WP_001026747.1.36496 WP_001026747.1.36500 WP_001026747.1.36507 WP_001026747.1.36523 WP_001026747.1.36531 WP_001026747.1.36537 WP_001026747.1.36610 WP_001026747.1.36627 WP_001026747.1.36628 WP_001026747.1.36707 WP_001026747.1.3671 WP_001026747.1.36739 WP_001026747.1.36746 WP_001026747.1.36747 WP_001026747.1.36806 WP_001026747.1.36812 WP_001026747.1.36817 WP_001026747.1.36826 WP_001026747.1.36833 WP_001026747.1.36904 WP_001026747.1.36925 WP_001026747.1.36975 WP_001026747.1.37006 WP_001026747.1.37020 WP_001026747.1.37046 WP_001026747.1.37057 WP_001026747.1.37076 WP_001026747.1.37099 WP_001026747.1.37122 WP_001026747.1.37146 WP_001026747.1.37155 WP_001026747.1.37206 WP_001026747.1.3723 WP_001026747.1.37233 WP_001026747.1.37252 WP_001026747.1.37261 WP_001026747.1.37329 WP_001026747.1.37334 WP_001026747.1.37352 WP_001026747.1.37360 WP_001026747.1.37371 WP_001026747.1.37419 WP_001026747.1.37433 WP_001026747.1.37445 WP_001026747.1.37476 WP_001026747.1.37485 WP_001026747.1.3749 WP_001026747.1.37510 WP_001026747.1.37538 WP_001026747.1.37549 WP_001026747.1.37554 WP_001026747.1.37576 WP_001026747.1.37588 WP_001026747.1.37634 WP_001026747.1.37637 WP_001026747.1.377 WP_001026747.1.3772 WP_001026747.1.37730 WP_001026747.1.37745 WP_001026747.1.37750 WP_001026747.1.37758 WP_001026747.1.37762 WP_001026747.1.37773 WP_001026747.1.37817 WP_001026747.1.37830 WP_001026747.1.37847 WP_001026747.1.37852 WP_001026747.1.3788 WP_001026747.1.37880 WP_001026747.1.37887 WP_001026747.1.37897 WP_001026747.1.37917 WP_001026747.1.37926 WP_001026747.1.37940 WP_001026747.1.37964 WP_001026747.1.37967 WP_001026747.1.37995 WP_001026747.1.38033 WP_001026747.1.38080 WP_001026747.1.38081 WP_001026747.1.38085 WP_001026747.1.38103 WP_001026747.1.38105 WP_001026747.1.3811 WP_001026747.1.38119 WP_001026747.1.38120 WP_001026747.1.3815 WP_001026747.1.38155 WP_001026747.1.38162 WP_001026747.1.38202 WP_001026747.1.38211 WP_001026747.1.3822 WP_001026747.1.38234 WP_001026747.1.38257 WP_001026747.1.38314 WP_001026747.1.38323 WP_001026747.1.38357 WP_001026747.1.38363 WP_001026747.1.38371 WP_001026747.1.38412 WP_001026747.1.38419 WP_001026747.1.38485 WP_001026747.1.38533 WP_001026747.1.38544 WP_001026747.1.38584 WP_001026747.1.38610 WP_001026747.1.38626 WP_001026747.1.38629 WP_001026747.1.38636 WP_001026747.1.38694 WP_001026747.1.38722 WP_001026747.1.3873 WP_001026747.1.38777 WP_001026747.1.38811 WP_001026747.1.38827 WP_001026747.1.38843 WP_001026747.1.38896 WP_001026747.1.38911 WP_001026747.1.38920 WP_001026747.1.38935 WP_001026747.1.38950 WP_001026747.1.39005 WP_001026747.1.39037 WP_001026747.1.3904 WP_001026747.1.39042 WP_001026747.1.39063 WP_001026747.1.39103 WP_001026747.1.39123 WP_001026747.1.39148 WP_001026747.1.39150 WP_001026747.1.39155 WP_001026747.1.39164 WP_001026747.1.39167 WP_001026747.1.39171 WP_001026747.1.39196 WP_001026747.1.3921 WP_001026747.1.39249 WP_001026747.1.39254 WP_001026747.1.39286 WP_001026747.1.39302 WP_001026747.1.39305 WP_001026747.1.39342 WP_001026747.1.39356 WP_001026747.1.39358 WP_001026747.1.39365 WP_001026747.1.39430 WP_001026747.1.39481 WP_001026747.1.39509 WP_001026747.1.39531 WP_001026747.1.3954 WP_001026747.1.39541 WP_001026747.1.39575 WP_001026747.1.39594 WP_001026747.1.39606 WP_001026747.1.39607 WP_001026747.1.39610 WP_001026747.1.39626 WP_001026747.1.39636 WP_001026747.1.39690 WP_001026747.1.3970 WP_001026747.1.39715 WP_001026747.1.39730 WP_001026747.1.39758 WP_001026747.1.39780 WP_001026747.1.39796 WP_001026747.1.3980 WP_001026747.1.39818 WP_001026747.1.39822 WP_001026747.1.39829 WP_001026747.1.39870 WP_001026747.1.39938 WP_001026747.1.39961 WP_001026747.1.39966 WP_001026747.1.39970 WP_001026747.1.39992 WP_001026747.1.40013 WP_001026747.1.40016 WP_001026747.1.40088 WP_001026747.1.40147 WP_001026747.1.40159 WP_001026747.1.40192 WP_001026747.1.4020 WP_001026747.1.40206 WP_001026747.1.40212 WP_001026747.1.40218 WP_001026747.1.40238 WP_001026747.1.40249 WP_001026747.1.40315 WP_001026747.1.40317 WP_001026747.1.40319 WP_001026747.1.40335 WP_001026747.1.40382 WP_001026747.1.40389 WP_001026747.1.40391 WP_001026747.1.40403 WP_001026747.1.40445 WP_001026747.1.4049 WP_001026747.1.40499 WP_001026747.1.40502 WP_001026747.1.40509 WP_001026747.1.40524 WP_001026747.1.40548 WP_001026747.1.40563 WP_001026747.1.40596 WP_001026747.1.40599 WP_001026747.1.406 WP_001026747.1.40617 WP_001026747.1.40623 WP_001026747.1.40666 WP_001026747.1.40686 WP_001026747.1.40712 WP_001026747.1.40781 WP_001026747.1.4081 WP_001026747.1.40813 WP_001026747.1.40815 WP_001026747.1.4082 WP_001026747.1.40833 WP_001026747.1.40865 WP_001026747.1.40898 WP_001026747.1.40912 WP_001026747.1.40937 WP_001026747.1.40965 WP_001026747.1.41037 WP_001026747.1.41045 WP_001026747.1.41125 WP_001026747.1.41147 WP_001026747.1.41206 WP_001026747.1.41230 WP_001026747.1.41239 WP_001026747.1.41259 WP_001026747.1.4126 WP_001026747.1.41263 WP_001026747.1.41271 WP_001026747.1.41287 WP_001026747.1.41315 WP_001026747.1.41339 WP_001026747.1.41346 WP_001026747.1.41363 WP_001026747.1.41368 WP_001026747.1.41371 WP_001026747.1.41391 WP_001026747.1.41392 WP_001026747.1.41402 WP_001026747.1.41407 WP_001026747.1.41417 WP_001026747.1.4142 WP_001026747.1.41436 WP_001026747.1.41449 WP_001026747.1.41455 WP_001026747.1.41457 WP_001026747.1.41466 WP_001026747.1.41479 WP_001026747.1.41484 WP_001026747.1.41513 WP_001026747.1.41530 WP_001026747.1.41539 WP_001026747.1.41545 WP_001026747.1.41556 WP_001026747.1.41566 WP_001026747.1.4158 WP_001026747.1.41613 WP_001026747.1.41621 WP_001026747.1.41651 WP_001026747.1.41654 WP_001026747.1.41712 WP_001026747.1.4172 WP_001026747.1.41740 WP_001026747.1.41752 WP_001026747.1.41778 WP_001026747.1.41780 WP_001026747.1.41782 WP_001026747.1.41784 WP_001026747.1.41812 WP_001026747.1.41813 WP_001026747.1.41826 WP_001026747.1.41900 WP_001026747.1.41960 WP_001026747.1.41964 WP_001026747.1.41988 WP_001026747.1.41991 WP_001026747.1.42022 WP_001026747.1.42027 WP_001026747.1.42033 WP_001026747.1.42038 WP_001026747.1.42060 WP_001026747.1.42095 WP_001026747.1.42096 WP_001026747.1.42113 WP_001026747.1.42138 WP_001026747.1.4214 WP_001026747.1.42159 WP_001026747.1.42179 WP_001026747.1.42203 WP_001026747.1.42209 WP_001026747.1.42214 WP_001026747.1.42226 WP_001026747.1.4224 WP_001026747.1.42252 WP_001026747.1.42277 WP_001026747.1.42284 WP_001026747.1.42300 WP_001026747.1.42318 WP_001026747.1.42359 WP_001026747.1.42367 WP_001026747.1.42376 WP_001026747.1.42387 WP_001026747.1.42415 WP_001026747.1.4242 WP_001026747.1.42432 WP_001026747.1.42442 WP_001026747.1.42448 WP_001026747.1.42456 WP_001026747.1.42480 WP_001026747.1.42522 WP_001026747.1.42547 WP_001026747.1.42632 WP_001026747.1.42661 WP_001026747.1.42728 WP_001026747.1.42748 WP_001026747.1.42749 WP_001026747.1.42756 WP_001026747.1.42770 WP_001026747.1.42791 WP_001026747.1.42808 WP_001026747.1.42813 WP_001026747.1.4282 WP_001026747.1.42828 WP_001026747.1.42832 WP_001026747.1.42879 WP_001026747.1.42880 WP_001026747.1.42891 WP_001026747.1.4290 WP_001026747.1.42918 WP_001026747.1.42936 WP_001026747.1.42937 WP_001026747.1.42950 WP_001026747.1.42962 WP_001026747.1.42966 WP_001026747.1.42987 WP_001026747.1.42989 WP_001026747.1.43035 WP_001026747.1.4306 WP_001026747.1.43132 WP_001026747.1.43137 WP_001026747.1.43166 WP_001026747.1.43174 WP_001026747.1.43177 WP_001026747.1.43239 WP_001026747.1.43270 WP_001026747.1.43316 WP_001026747.1.43363 WP_001026747.1.43389 WP_001026747.1.4342 WP_001026747.1.43444 WP_001026747.1.43455 WP_001026747.1.43473 WP_001026747.1.43474 WP_001026747.1.43489 WP_001026747.1.43561 WP_001026747.1.43598 WP_001026747.1.43622 WP_001026747.1.43642 WP_001026747.1.43720 WP_001026747.1.43750 WP_001026747.1.43769 WP_001026747.1.43804 WP_001026747.1.43925 WP_001026747.1.43989 WP_001026747.1.4400 WP_001026747.1.44018 WP_001026747.1.44020 WP_001026747.1.44029 WP_001026747.1.44075 WP_001026747.1.44077 WP_001026747.1.44088 WP_001026747.1.44096 WP_001026747.1.44100 WP_001026747.1.4411 WP_001026747.1.44115 WP_001026747.1.4415 WP_001026747.1.44162 WP_001026747.1.44166 WP_001026747.1.44201 WP_001026747.1.44211 WP_001026747.1.44222 WP_001026747.1.44238 WP_001026747.1.44264 WP_001026747.1.44273 WP_001026747.1.44285 WP_001026747.1.44287 WP_001026747.1.44292 WP_001026747.1.44324 WP_001026747.1.44365 WP_001026747.1.44394 WP_001026747.1.44424 WP_001026747.1.44426 WP_001026747.1.44445 WP_001026747.1.4445 WP_001026747.1.44452 WP_001026747.1.44458 WP_001026747.1.44461 WP_001026747.1.4449 WP_001026747.1.44524 WP_001026747.1.44558 WP_001026747.1.44570 WP_001026747.1.44587 WP_001026747.1.44608 WP_001026747.1.44610 WP_001026747.1.44627 WP_001026747.1.4463 WP_001026747.1.44642 WP_001026747.1.44661 WP_001026747.1.44668 WP_001026747.1.44671 WP_001026747.1.44724 WP_001026747.1.4473 WP_001026747.1.44756 WP_001026747.1.44821 WP_001026747.1.44840 WP_001026747.1.44841 WP_001026747.1.44849 WP_001026747.1.44854 WP_001026747.1.44857 WP_001026747.1.44923 WP_001026747.1.44960 WP_001026747.1.44961 WP_001026747.1.44970 WP_001026747.1.44975 WP_001026747.1.44980 WP_001026747.1.45000 WP_001026747.1.45025 WP_001026747.1.45028 WP_001026747.1.45043 WP_001026747.1.45053 WP_001026747.1.45068 WP_001026747.1.45104 WP_001026747.1.45116 WP_001026747.1.4516 WP_001026747.1.45208 WP_001026747.1.4524 WP_001026747.1.45246 WP_001026747.1.45301 WP_001026747.1.45313 WP_001026747.1.45329 WP_001026747.1.4535 WP_001026747.1.45359 WP_001026747.1.45392 WP_001026747.1.45440 WP_001026747.1.45444 WP_001026747.1.4549 WP_001026747.1.45538 WP_001026747.1.45581 WP_001026747.1.45595 WP_001026747.1.45600 WP_001026747.1.4563 WP_001026747.1.45674 WP_001026747.1.4570 WP_001026747.1.45718 WP_001026747.1.4574 WP_001026747.1.45741 WP_001026747.1.45752 WP_001026747.1.45799 WP_001026747.1.45840 WP_001026747.1.45846 WP_001026747.1.45865 WP_001026747.1.45868 WP_001026747.1.4593 WP_001026747.1.45930 WP_001026747.1.45931 WP_001026747.1.45933 WP_001026747.1.45949 WP_001026747.1.45960 WP_001026747.1.45968 WP_001026747.1.45991 WP_001026747.1.4600 WP_001026747.1.46026 WP_001026747.1.46027 WP_001026747.1.46048 WP_001026747.1.46049 WP_001026747.1.46070 WP_001026747.1.46081 WP_001026747.1.46097 WP_001026747.1.46105 WP_001026747.1.46115 WP_001026747.1.46122 WP_001026747.1.4613 WP_001026747.1.4617 WP_001026747.1.46186 WP_001026747.1.46197 WP_001026747.1.46213 WP_001026747.1.46239 WP_001026747.1.46245 WP_001026747.1.46257 WP_001026747.1.46301 WP_001026747.1.46325 WP_001026747.1.46329 WP_001026747.1.46379 WP_001026747.1.46429 WP_001026747.1.4643 WP_001026747.1.46433 WP_001026747.1.46441 WP_001026747.1.4646 WP_001026747.1.46468 WP_001026747.1.46477 WP_001026747.1.46526 WP_001026747.1.46541 WP_001026747.1.46552 WP_001026747.1.46555 WP_001026747.1.4657 WP_001026747.1.46573 WP_001026747.1.46582 WP_001026747.1.46602 WP_001026747.1.46614 WP_001026747.1.46616 WP_001026747.1.46643 WP_001026747.1.46655 WP_001026747.1.46668 WP_001026747.1.4670 WP_001026747.1.46734 WP_001026747.1.46743 WP_001026747.1.46802 WP_001026747.1.46857 WP_001026747.1.46860 WP_001026747.1.46876 WP_001026747.1.46882 WP_001026747.1.46898 WP_001026747.1.46909 WP_001026747.1.4691 WP_001026747.1.46912 WP_001026747.1.46932 WP_001026747.1.46990 WP_001026747.1.46999 WP_001026747.1.47028 WP_001026747.1.47029 WP_001026747.1.47030 WP_001026747.1.47034 WP_001026747.1.47038 WP_001026747.1.47048 WP_001026747.1.47050 WP_001026747.1.47063 WP_001026747.1.47069 WP_001026747.1.47156 WP_001026747.1.47167 WP_001026747.1.47171 WP_001026747.1.47186 WP_001026747.1.47198 WP_001026747.1.4722 WP_001026747.1.47224 WP_001026747.1.47246 WP_001026747.1.47280 WP_001026747.1.47307 WP_001026747.1.47316 WP_001026747.1.47319 WP_001026747.1.47322 WP_001026747.1.47332 WP_001026747.1.47350 WP_001026747.1.47356 WP_001026747.1.47363 WP_001026747.1.47370 WP_001026747.1.47398 WP_001026747.1.4740 WP_001026747.1.47401 WP_001026747.1.47414 WP_001026747.1.47425 WP_001026747.1.47451 WP_001026747.1.47473 WP_001026747.1.47477 WP_001026747.1.47496 WP_001026747.1.47529 WP_001026747.1.47555 WP_001026747.1.47582 WP_001026747.1.47634 WP_001026747.1.47646 WP_001026747.1.47662 WP_001026747.1.47673 WP_001026747.1.4772 WP_001026747.1.47722 WP_001026747.1.47734 WP_001026747.1.47740 WP_001026747.1.47744 WP_001026747.1.47761 WP_001026747.1.47764 WP_001026747.1.47765 WP_001026747.1.47770 WP_001026747.1.47775 WP_001026747.1.47790 WP_001026747.1.47791 WP_001026747.1.47820 WP_001026747.1.47848 WP_001026747.1.4785 WP_001026747.1.4796 WP_001026747.1.47962 WP_001026747.1.47976 WP_001026747.1.47983 WP_001026747.1.48000 WP_001026747.1.48018 WP_001026747.1.48040 WP_001026747.1.48048 WP_001026747.1.48073 WP_001026747.1.48077 WP_001026747.1.48080 WP_001026747.1.48090 WP_001026747.1.48096 WP_001026747.1.4811 WP_001026747.1.48111 WP_001026747.1.48144 WP_001026747.1.48188 WP_001026747.1.48194 WP_001026747.1.48200 WP_001026747.1.48203 WP_001026747.1.48216 WP_001026747.1.48222 WP_001026747.1.48285 WP_001026747.1.48290 WP_001026747.1.48291 WP_001026747.1.48353 WP_001026747.1.48355 WP_001026747.1.48371 WP_001026747.1.48385 WP_001026747.1.48417 WP_001026747.1.48421 WP_001026747.1.48433 WP_001026747.1.48477 WP_001026747.1.48480 WP_001026747.1.48483 WP_001026747.1.48505 WP_001026747.1.48522 WP_001026747.1.4857 WP_001026747.1.48571 WP_001026747.1.486 WP_001026747.1.48602 WP_001026747.1.48615 WP_001026747.1.48678 WP_001026747.1.4871 WP_001026747.1.48771 WP_001026747.1.48801 WP_001026747.1.48825 WP_001026747.1.48847 WP_001026747.1.48860 WP_001026747.1.48901 WP_001026747.1.48907 WP_001026747.1.48921 WP_001026747.1.48926 WP_001026747.1.48928 WP_001026747.1.48953 WP_001026747.1.48954 WP_001026747.1.48970 WP_001026747.1.48974 WP_001026747.1.49009 WP_001026747.1.49104 WP_001026747.1.49107 WP_001026747.1.49124 WP_001026747.1.49136 WP_001026747.1.49147 WP_001026747.1.49190 WP_001026747.1.49229 WP_001026747.1.49236 WP_001026747.1.49243 WP_001026747.1.49259 WP_001026747.1.49312 WP_001026747.1.49336 WP_001026747.1.49363 WP_001026747.1.49431 WP_001026747.1.49459 WP_001026747.1.49481 WP_001026747.1.49482 WP_001026747.1.4949 WP_001026747.1.4953 WP_001026747.1.49531 WP_001026747.1.49537 WP_001026747.1.49546 WP_001026747.1.49558 WP_001026747.1.49599 WP_001026747.1.49621 WP_001026747.1.49645 WP_001026747.1.49661 WP_001026747.1.49684 WP_001026747.1.497 WP_001026747.1.49712 WP_001026747.1.49722 WP_001026747.1.49733 WP_001026747.1.49747 WP_001026747.1.49768 WP_001026747.1.49774 WP_001026747.1.49777 WP_001026747.1.49856 WP_001026747.1.49861 WP_001026747.1.49879 WP_001026747.1.49883 WP_001026747.1.49900 WP_001026747.1.49902 WP_001026747.1.49950 WP_001026747.1.49954 WP_001026747.1.49987 WP_001026747.1.50006 WP_001026747.1.50008 WP_001026747.1.50036 WP_001026747.1.50078 WP_001026747.1.50098 WP_001026747.1.50113 WP_001026747.1.50119 WP_001026747.1.5017 WP_001026747.1.50182 WP_001026747.1.50191 WP_001026747.1.50196 WP_001026747.1.50207 WP_001026747.1.50230 WP_001026747.1.50258 WP_001026747.1.50262 WP_001026747.1.50266 WP_001026747.1.50269 WP_001026747.1.50273 WP_001026747.1.50353 WP_001026747.1.50361 WP_001026747.1.50366 WP_001026747.1.50381 WP_001026747.1.5040 WP_001026747.1.5041 WP_001026747.1.50412 WP_001026747.1.50418 WP_001026747.1.50452 WP_001026747.1.5046 WP_001026747.1.50539 WP_001026747.1.50548 WP_001026747.1.5056 WP_001026747.1.50564 WP_001026747.1.50579 WP_001026747.1.50586 WP_001026747.1.506 WP_001026747.1.50616 WP_001026747.1.5064 WP_001026747.1.5067 WP_001026747.1.50715 WP_001026747.1.50717 WP_001026747.1.50725 WP_001026747.1.50936 WP_001026747.1.50939 WP_001026747.1.5095 WP_001026747.1.50969 WP_001026747.1.50993 WP_001026747.1.50996 WP_001026747.1.51013 WP_001026747.1.51042 WP_001026747.1.51058 WP_001026747.1.5106 WP_001026747.1.51109 WP_001026747.1.51127 WP_001026747.1.51172 WP_001026747.1.51175 WP_001026747.1.51201 WP_001026747.1.51206 WP_001026747.1.51248 WP_001026747.1.51255 WP_001026747.1.51260 WP_001026747.1.51278 WP_001026747.1.5128 WP_001026747.1.51283 WP_001026747.1.51299 WP_001026747.1.51300 WP_001026747.1.51307 WP_001026747.1.51320 WP_001026747.1.51323 WP_001026747.1.51325 WP_001026747.1.51336 WP_001026747.1.51380 WP_001026747.1.51405 WP_001026747.1.51425 WP_001026747.1.51427 WP_001026747.1.51430 WP_001026747.1.51441 WP_001026747.1.5146 WP_001026747.1.51462 WP_001026747.1.51490 WP_001026747.1.51495 WP_001026747.1.51525 WP_001026747.1.51537 WP_001026747.1.51539 WP_001026747.1.51542 WP_001026747.1.51548 WP_001026747.1.51552 WP_001026747.1.5157 WP_001026747.1.51580 WP_001026747.1.51587 WP_001026747.1.51600 WP_001026747.1.51607 WP_001026747.1.51629 WP_001026747.1.51718 WP_001026747.1.5172 WP_001026747.1.51736 WP_001026747.1.51760 WP_001026747.1.51784 WP_001026747.1.51837 WP_001026747.1.51839 WP_001026747.1.51869 WP_001026747.1.51873 WP_001026747.1.51899 WP_001026747.1.51968 WP_001026747.1.51985 WP_001026747.1.51988 WP_001026747.1.51999 WP_001026747.1.52002 WP_001026747.1.52011 WP_001026747.1.52020 WP_001026747.1.52062 WP_001026747.1.52076 WP_001026747.1.52111 WP_001026747.1.52126 WP_001026747.1.52127 WP_001026747.1.52135 WP_001026747.1.52171 WP_001026747.1.52186 WP_001026747.1.52200 WP_001026747.1.52211 WP_001026747.1.52214 WP_001026747.1.52230 WP_001026747.1.52236 WP_001026747.1.52240 WP_001026747.1.52243 WP_001026747.1.52249 WP_001026747.1.5227 WP_001026747.1.52272 WP_001026747.1.52305 WP_001026747.1.52313 WP_001026747.1.52378 WP_001026747.1.5239 WP_001026747.1.52406 WP_001026747.1.52419 WP_001026747.1.52421 WP_001026747.1.52492 WP_001026747.1.52524 WP_001026747.1.52544 WP_001026747.1.52554 WP_001026747.1.52558 WP_001026747.1.52568 WP_001026747.1.52601 WP_001026747.1.52612 WP_001026747.1.5265 WP_001026747.1.52662 WP_001026747.1.52691 WP_001026747.1.52704 WP_001026747.1.52710 WP_001026747.1.5272 WP_001026747.1.52735 WP_001026747.1.52762 WP_001026747.1.52771 WP_001026747.1.52774 WP_001026747.1.52777 WP_001026747.1.52780 WP_001026747.1.52801 WP_001026747.1.52844 WP_001026747.1.52846 WP_001026747.1.52852 WP_001026747.1.52853 WP_001026747.1.52881 WP_001026747.1.52895 WP_001026747.1.52908 WP_001026747.1.5291 WP_001026747.1.52913 WP_001026747.1.52942 WP_001026747.1.52962 WP_001026747.1.52995 WP_001026747.1.53012 WP_001026747.1.53020 WP_001026747.1.53027 WP_001026747.1.53065 WP_001026747.1.53099 WP_001026747.1.5310 WP_001026747.1.53110 WP_001026747.1.532 WP_001026747.1.5322 WP_001026747.1.53223 WP_001026747.1.53238 WP_001026747.1.53242 WP_001026747.1.53244 WP_001026747.1.53251 WP_001026747.1.53262 WP_001026747.1.53277 WP_001026747.1.53356 WP_001026747.1.53364 WP_001026747.1.53377 WP_001026747.1.53401 WP_001026747.1.53419 WP_001026747.1.5342 WP_001026747.1.53428 WP_001026747.1.53431 WP_001026747.1.53482 WP_001026747.1.53505 WP_001026747.1.5351 WP_001026747.1.53535 WP_001026747.1.53537 WP_001026747.1.53545 WP_001026747.1.53574 WP_001026747.1.53590 WP_001026747.1.53592 WP_001026747.1.53594 WP_001026747.1.5362 WP_001026747.1.53642 WP_001026747.1.53645 WP_001026747.1.53706 WP_001026747.1.53769 WP_001026747.1.53809 WP_001026747.1.53811 WP_001026747.1.53841 WP_001026747.1.53863 WP_001026747.1.53866 WP_001026747.1.53878 WP_001026747.1.53931 WP_001026747.1.53966 WP_001026747.1.53968 WP_001026747.1.53972 WP_001026747.1.53978 WP_001026747.1.53994 WP_001026747.1.54002 WP_001026747.1.54013 WP_001026747.1.54023 WP_001026747.1.54028 WP_001026747.1.54032 WP_001026747.1.54072 WP_001026747.1.54091 WP_001026747.1.54144 WP_001026747.1.54169 WP_001026747.1.54185 WP_001026747.1.54202 WP_001026747.1.54307 WP_001026747.1.54317 WP_001026747.1.54328 WP_001026747.1.54329 WP_001026747.1.5433 WP_001026747.1.54359 WP_001026747.1.5440 WP_001026747.1.54463 WP_001026747.1.54476 WP_001026747.1.54507 WP_001026747.1.54546 WP_001026747.1.54585 WP_001026747.1.54591 WP_001026747.1.5460 WP_001026747.1.54602 WP_001026747.1.54605 WP_001026747.1.5461 WP_001026747.1.54614 WP_001026747.1.54617 WP_001026747.1.54620 WP_001026747.1.54625 WP_001026747.1.54638 WP_001026747.1.54688 WP_001026747.1.54695 WP_001026747.1.5470 WP_001026747.1.54708 WP_001026747.1.54725 WP_001026747.1.54729 WP_001026747.1.54769 WP_001026747.1.5479 WP_001026747.1.54798 WP_001026747.1.54817 WP_001026747.1.54829 WP_001026747.1.54918 WP_001026747.1.54927 WP_001026747.1.54941 WP_001026747.1.54946 WP_001026747.1.54981 WP_001026747.1.54989 WP_001026747.1.54991 WP_001026747.1.55003 WP_001026747.1.55005 WP_001026747.1.55009 WP_001026747.1.55041 WP_001026747.1.55070 WP_001026747.1.55112 WP_001026747.1.55115 WP_001026747.1.5512 WP_001026747.1.55123 WP_001026747.1.55134 WP_001026747.1.55144 WP_001026747.1.55177 WP_001026747.1.55185 WP_001026747.1.55197 WP_001026747.1.5520 WP_001026747.1.55203 WP_001026747.1.55222 WP_001026747.1.55226 WP_001026747.1.55275 WP_001026747.1.55291 WP_001026747.1.55338 WP_001026747.1.55342 WP_001026747.1.55357 WP_001026747.1.55374 WP_001026747.1.55417 WP_001026747.1.55424 WP_001026747.1.55425 WP_001026747.1.55466 WP_001026747.1.55482 WP_001026747.1.55483 WP_001026747.1.55489 WP_001026747.1.55507 WP_001026747.1.55529 WP_001026747.1.55551 WP_001026747.1.55552 WP_001026747.1.55556 WP_001026747.1.55560 WP_001026747.1.55571 WP_001026747.1.55574 WP_001026747.1.55581 WP_001026747.1.55597 WP_001026747.1.55608 WP_001026747.1.5561 WP_001026747.1.55629 WP_001026747.1.5566 WP_001026747.1.55676 WP_001026747.1.55709 WP_001026747.1.55720 WP_001026747.1.55730 WP_001026747.1.55757 WP_001026747.1.55787 WP_001026747.1.55825 WP_001026747.1.55844 WP_001026747.1.55868 WP_001026747.1.55870 WP_001026747.1.55988 WP_001026747.1.561 WP_001026747.1.5614 WP_001026747.1.56149 WP_001026747.1.5616 WP_001026747.1.56164 WP_001026747.1.56177 WP_001026747.1.56193 WP_001026747.1.56197 WP_001026747.1.56216 WP_001026747.1.56231 WP_001026747.1.56285 WP_001026747.1.56302 WP_001026747.1.56345 WP_001026747.1.56358 WP_001026747.1.56371 WP_001026747.1.56390 WP_001026747.1.56399 WP_001026747.1.56436 WP_001026747.1.56439 WP_001026747.1.56446 WP_001026747.1.5646 WP_001026747.1.5649 WP_001026747.1.56513 WP_001026747.1.56528 WP_001026747.1.56543 WP_001026747.1.56573 WP_001026747.1.56586 WP_001026747.1.56665 WP_001026747.1.56680 WP_001026747.1.56689 WP_001026747.1.5670 WP_001026747.1.56704 WP_001026747.1.56713 WP_001026747.1.56721 WP_001026747.1.56742 WP_001026747.1.56776 WP_001026747.1.56777 WP_001026747.1.56786 WP_001026747.1.56787 WP_001026747.1.56789 WP_001026747.1.56799 WP_001026747.1.56830 WP_001026747.1.56835 WP_001026747.1.56846 WP_001026747.1.5685 WP_001026747.1.56871 WP_001026747.1.56882 WP_001026747.1.56885 WP_001026747.1.56908 WP_001026747.1.56932 WP_001026747.1.56934 WP_001026747.1.56937 WP_001026747.1.56951 WP_001026747.1.56980 WP_001026747.1.56992 WP_001026747.1.57051 WP_001026747.1.57072 WP_001026747.1.57086 WP_001026747.1.57100 WP_001026747.1.57124 WP_001026747.1.57150 WP_001026747.1.57181 WP_001026747.1.57185 WP_001026747.1.57216 WP_001026747.1.57222 WP_001026747.1.57254 WP_001026747.1.57269 WP_001026747.1.57281 WP_001026747.1.57319 WP_001026747.1.57348 WP_001026747.1.57349 WP_001026747.1.57401 WP_001026747.1.57403 WP_001026747.1.57410 WP_001026747.1.57414 WP_001026747.1.57432 WP_001026747.1.57438 WP_001026747.1.5748 WP_001026747.1.57487 WP_001026747.1.57538 WP_001026747.1.5755 WP_001026747.1.57558 WP_001026747.1.57588 WP_001026747.1.57628 WP_001026747.1.57629 WP_001026747.1.57638 WP_001026747.1.57659 WP_001026747.1.57663 WP_001026747.1.57669 WP_001026747.1.57719 WP_001026747.1.57738 WP_001026747.1.57812 WP_001026747.1.57814 WP_001026747.1.57846 WP_001026747.1.57851 WP_001026747.1.5786 WP_001026747.1.57898 WP_001026747.1.57904 WP_001026747.1.57920 WP_001026747.1.58001 WP_001026747.1.58022 WP_001026747.1.58045 WP_001026747.1.58060 WP_001026747.1.58080 WP_001026747.1.5810 WP_001026747.1.58128 WP_001026747.1.58136 WP_001026747.1.58143 WP_001026747.1.58146 WP_001026747.1.58163 WP_001026747.1.58172 WP_001026747.1.58206 WP_001026747.1.58226 WP_001026747.1.58232 WP_001026747.1.58244 WP_001026747.1.58267 WP_001026747.1.58289 WP_001026747.1.58316 WP_001026747.1.58368 WP_001026747.1.58371 WP_001026747.1.58384 WP_001026747.1.58401 WP_001026747.1.58408 WP_001026747.1.5842 WP_001026747.1.58420 WP_001026747.1.58429 WP_001026747.1.58440 WP_001026747.1.58445 WP_001026747.1.58475 WP_001026747.1.58484 WP_001026747.1.58496 WP_001026747.1.58507 WP_001026747.1.58514 WP_001026747.1.58528 WP_001026747.1.58547 WP_001026747.1.58572 WP_001026747.1.58582 WP_001026747.1.58622 WP_001026747.1.58705 WP_001026747.1.58837 WP_001026747.1.58867 WP_001026747.1.58870 WP_001026747.1.58901 WP_001026747.1.58940 WP_001026747.1.58942 WP_001026747.1.58951 WP_001026747.1.58958 WP_001026747.1.58976 WP_001026747.1.58977 WP_001026747.1.58983 WP_001026747.1.59026 WP_001026747.1.59047 WP_001026747.1.5906 WP_001026747.1.59083 WP_001026747.1.59119 WP_001026747.1.59165 WP_001026747.1.59174 WP_001026747.1.59190 WP_001026747.1.59199 WP_001026747.1.59226 WP_001026747.1.59263 WP_001026747.1.59280 WP_001026747.1.59293 WP_001026747.1.59302 WP_001026747.1.59306 WP_001026747.1.59395 WP_001026747.1.59396 WP_001026747.1.59407 WP_001026747.1.59409 WP_001026747.1.59413 WP_001026747.1.59423 WP_001026747.1.59434 WP_001026747.1.59513 WP_001026747.1.59533 WP_001026747.1.59553 WP_001026747.1.59590 WP_001026747.1.59615 WP_001026747.1.59621 WP_001026747.1.59689 WP_001026747.1.59699 WP_001026747.1.597 WP_001026747.1.59717 WP_001026747.1.59730 WP_001026747.1.59737 WP_001026747.1.59756 WP_001026747.1.59781 WP_001026747.1.59782 WP_001026747.1.59791 WP_001026747.1.59823 WP_001026747.1.59836 WP_001026747.1.59855 WP_001026747.1.59877 WP_001026747.1.59912 WP_001026747.1.59932 WP_001026747.1.59989 WP_001026747.1.59998 WP_001026747.1.60005 WP_001026747.1.6002 WP_001026747.1.60031 WP_001026747.1.60067 WP_001026747.1.60070 WP_001026747.1.60095 WP_001026747.1.60151 WP_001026747.1.60186 WP_001026747.1.6022 WP_001026747.1.60228 WP_001026747.1.60325 WP_001026747.1.60342 WP_001026747.1.60343 WP_001026747.1.60387 WP_001026747.1.60436 WP_001026747.1.60453 WP_001026747.1.60457 WP_001026747.1.60477 WP_001026747.1.60491 WP_001026747.1.60498 WP_001026747.1.60505 WP_001026747.1.60567 WP_001026747.1.6059 WP_001026747.1.60599 WP_001026747.1.60606 WP_001026747.1.6061 WP_001026747.1.6064 WP_001026747.1.6066 WP_001026747.1.60698 WP_001026747.1.60717 WP_001026747.1.60732 WP_001026747.1.60764 WP_001026747.1.60771 WP_001026747.1.60805 WP_001026747.1.60832 WP_001026747.1.60835 WP_001026747.1.60847 WP_001026747.1.60895 WP_001026747.1.60901 WP_001026747.1.60925 WP_001026747.1.60927 WP_001026747.1.6094 WP_001026747.1.60974 WP_001026747.1.61005 WP_001026747.1.61008 WP_001026747.1.61035 WP_001026747.1.61046 WP_001026747.1.61058 WP_001026747.1.6106 WP_001026747.1.61096 WP_001026747.1.6110 WP_001026747.1.61102 WP_001026747.1.61112 WP_001026747.1.61170 WP_001026747.1.61174 WP_001026747.1.61181 WP_001026747.1.61183 WP_001026747.1.61223 WP_001026747.1.61225 WP_001026747.1.61241 WP_001026747.1.61292 WP_001026747.1.61360 WP_001026747.1.61398 WP_001026747.1.61496 WP_001026747.1.61505 WP_001026747.1.61512 WP_001026747.1.61517 WP_001026747.1.61524 WP_001026747.1.61551 WP_001026747.1.61608 WP_001026747.1.61636 WP_001026747.1.61663 WP_001026747.1.61703 WP_001026747.1.61718 WP_001026747.1.61758 WP_001026747.1.61770 WP_001026747.1.61779 WP_001026747.1.61806 WP_001026747.1.61822 WP_001026747.1.61853 WP_001026747.1.61858 WP_001026747.1.61893 WP_001026747.1.61926 WP_001026747.1.61939 WP_001026747.1.61948 WP_001026747.1.61949 WP_001026747.1.61955 WP_001026747.1.61957 WP_001026747.1.62041 WP_001026747.1.6212 WP_001026747.1.62264 WP_001026747.1.62266 WP_001026747.1.62273 WP_001026747.1.62282 WP_001026747.1.62290 WP_001026747.1.62296 WP_001026747.1.62337 WP_001026747.1.62358 WP_001026747.1.62447 WP_001026747.1.62460 WP_001026747.1.62487 WP_001026747.1.62514 WP_001026747.1.62529 WP_001026747.1.62612 WP_001026747.1.62642 WP_001026747.1.62646 WP_001026747.1.62668 WP_001026747.1.62681 WP_001026747.1.62714 WP_001026747.1.62735 WP_001026747.1.62750 WP_001026747.1.62762 WP_001026747.1.62769 WP_001026747.1.62787 WP_001026747.1.62812 WP_001026747.1.62818 WP_001026747.1.62840 WP_001026747.1.62850 WP_001026747.1.62851 WP_001026747.1.62914 WP_001026747.1.62919 WP_001026747.1.6293 WP_001026747.1.62931 WP_001026747.1.62959 WP_001026747.1.62973 WP_001026747.1.62989 WP_001026747.1.6299 WP_001026747.1.62992 WP_001026747.1.63113 WP_001026747.1.63167 WP_001026747.1.63177 WP_001026747.1.63189 WP_001026747.1.6323 WP_001026747.1.63246 WP_001026747.1.63287 WP_001026747.1.63350 WP_001026747.1.6337 WP_001026747.1.63370 WP_001026747.1.63374 WP_001026747.1.63393 WP_001026747.1.63437 WP_001026747.1.63453 WP_001026747.1.63466 WP_001026747.1.63467 WP_001026747.1.63470 WP_001026747.1.63478 WP_001026747.1.63484 WP_001026747.1.63487 WP_001026747.1.63491 WP_001026747.1.63536 WP_001026747.1.63554 WP_001026747.1.63556 WP_001026747.1.63576 WP_001026747.1.63602 WP_001026747.1.63612 WP_001026747.1.63666 WP_001026747.1.63683 WP_001026747.1.63703 WP_001026747.1.63721 WP_001026747.1.63746 WP_001026747.1.63800 WP_001026747.1.63821 WP_001026747.1.63871 WP_001026747.1.63964 WP_001026747.1.63990 WP_001026747.1.64008 WP_001026747.1.64014 WP_001026747.1.64040 WP_001026747.1.64050 WP_001026747.1.64074 WP_001026747.1.64080 WP_001026747.1.64110 WP_001026747.1.64150 WP_001026747.1.64153 WP_001026747.1.6416 WP_001026747.1.64175 WP_001026747.1.64193 WP_001026747.1.64280 WP_001026747.1.64285 WP_001026747.1.64286 WP_001026747.1.6431 WP_001026747.1.64321 WP_001026747.1.64330 WP_001026747.1.64337 WP_001026747.1.64353 WP_001026747.1.64355 WP_001026747.1.64356 WP_001026747.1.64391 WP_001026747.1.6441 WP_001026747.1.64438 WP_001026747.1.64448 WP_001026747.1.64458 WP_001026747.1.64519 WP_001026747.1.64528 WP_001026747.1.64563 WP_001026747.1.6469 WP_001026747.1.64693 WP_001026747.1.647 WP_001026747.1.64707 WP_001026747.1.64746 WP_001026747.1.64749 WP_001026747.1.64784 WP_001026747.1.64789 WP_001026747.1.64793 WP_001026747.1.64821 WP_001026747.1.64866 WP_001026747.1.64881 WP_001026747.1.64926 WP_001026747.1.64930 WP_001026747.1.64939 WP_001026747.1.64970 WP_001026747.1.6499 WP_001026747.1.65023 WP_001026747.1.65040 WP_001026747.1.65056 WP_001026747.1.65097 WP_001026747.1.651 WP_001026747.1.65110 WP_001026747.1.65135 WP_001026747.1.65151 WP_001026747.1.65155 WP_001026747.1.6516 WP_001026747.1.65179 WP_001026747.1.65192 WP_001026747.1.65206 WP_001026747.1.65256 WP_001026747.1.65271 WP_001026747.1.65296 WP_001026747.1.65305 WP_001026747.1.65306 WP_001026747.1.65353 WP_001026747.1.65364 WP_001026747.1.6537 WP_001026747.1.65370 WP_001026747.1.654 WP_001026747.1.65408 WP_001026747.1.65413 WP_001026747.1.65415 WP_001026747.1.65484 WP_001026747.1.65493 WP_001026747.1.6553 WP_001026747.1.65531 WP_001026747.1.65581 WP_001026747.1.65596 WP_001026747.1.65708 WP_001026747.1.65762 WP_001026747.1.65912 WP_001026747.1.65954 WP_001026747.1.65961 WP_001026747.1.65962 WP_001026747.1.6599 WP_001026747.1.66001 WP_001026747.1.66016 WP_001026747.1.6604 WP_001026747.1.66050 WP_001026747.1.66059 WP_001026747.1.6609 WP_001026747.1.66094 WP_001026747.1.66102 WP_001026747.1.66104 WP_001026747.1.66121 WP_001026747.1.66127 WP_001026747.1.66181 WP_001026747.1.66187 WP_001026747.1.66197 WP_001026747.1.66251 WP_001026747.1.66264 WP_001026747.1.66280 WP_001026747.1.66288 WP_001026747.1.66327 WP_001026747.1.66335 WP_001026747.1.6635 WP_001026747.1.66387 WP_001026747.1.66389 WP_001026747.1.66395 WP_001026747.1.66412 WP_001026747.1.66432 WP_001026747.1.6645 WP_001026747.1.66501 WP_001026747.1.6654 WP_001026747.1.66550 WP_001026747.1.66559 WP_001026747.1.66579 WP_001026747.1.66624 WP_001026747.1.66644 WP_001026747.1.6665 WP_001026747.1.66700 WP_001026747.1.66719 WP_001026747.1.66751 WP_001026747.1.66758 WP_001026747.1.6676 WP_001026747.1.66783 WP_001026747.1.66791 WP_001026747.1.66795 WP_001026747.1.66849 WP_001026747.1.66933 WP_001026747.1.66948 WP_001026747.1.66978 WP_001026747.1.6701 WP_001026747.1.67018 WP_001026747.1.67021 WP_001026747.1.67022 WP_001026747.1.67026 WP_001026747.1.6706 WP_001026747.1.67102 WP_001026747.1.67116 WP_001026747.1.67120 WP_001026747.1.67137 WP_001026747.1.67149 WP_001026747.1.67194 WP_001026747.1.67200 WP_001026747.1.67209 WP_001026747.1.6723 WP_001026747.1.67272 WP_001026747.1.67278 WP_001026747.1.67293 WP_001026747.1.6735 WP_001026747.1.67383 WP_001026747.1.67412 WP_001026747.1.67415 WP_001026747.1.67452 WP_001026747.1.67454 WP_001026747.1.67468 WP_001026747.1.67522 WP_001026747.1.67538 WP_001026747.1.67549 WP_001026747.1.67553 WP_001026747.1.67581 WP_001026747.1.67660 WP_001026747.1.67663 WP_001026747.1.67701 WP_001026747.1.67724 WP_001026747.1.67732 WP_001026747.1.67786 WP_001026747.1.67787 WP_001026747.1.67788 WP_001026747.1.678 WP_001026747.1.67841 WP_001026747.1.67853 WP_001026747.1.67861 WP_001026747.1.67901 WP_001026747.1.6793 WP_001026747.1.67938 WP_001026747.1.67975 WP_001026747.1.67990 WP_001026747.1.67999 WP_001026747.1.68008 WP_001026747.1.68011 WP_001026747.1.6802 WP_001026747.1.68025 WP_001026747.1.6803 WP_001026747.1.68039 WP_001026747.1.68053 WP_001026747.1.68067 WP_001026747.1.68069 WP_001026747.1.68070 WP_001026747.1.68079 WP_001026747.1.6810 WP_001026747.1.68138 WP_001026747.1.6814 WP_001026747.1.68170 WP_001026747.1.68175 WP_001026747.1.682 WP_001026747.1.68215 WP_001026747.1.68241 WP_001026747.1.68255 WP_001026747.1.68271 WP_001026747.1.68278 WP_001026747.1.68283 WP_001026747.1.68300 WP_001026747.1.68336 WP_001026747.1.68341 WP_001026747.1.68347 WP_001026747.1.68369 WP_001026747.1.68396 WP_001026747.1.68442 WP_001026747.1.68490 WP_001026747.1.68534 WP_001026747.1.68566 WP_001026747.1.68584 WP_001026747.1.6860 WP_001026747.1.68609 WP_001026747.1.68630 WP_001026747.1.68635 WP_001026747.1.68673 WP_001026747.1.68678 WP_001026747.1.68679 WP_001026747.1.68695 WP_001026747.1.68697 WP_001026747.1.68711 WP_001026747.1.68731 WP_001026747.1.68751 WP_001026747.1.68752 WP_001026747.1.6877 WP_001026747.1.68797 WP_001026747.1.68801 WP_001026747.1.68865 WP_001026747.1.68880 WP_001026747.1.68956 WP_001026747.1.68961 WP_001026747.1.6897 WP_001026747.1.68989 WP_001026747.1.69033 WP_001026747.1.69039 WP_001026747.1.69098 WP_001026747.1.69126 WP_001026747.1.69127 WP_001026747.1.69144 WP_001026747.1.6916 WP_001026747.1.69160 WP_001026747.1.6921 WP_001026747.1.6923 WP_001026747.1.69247 WP_001026747.1.69258 WP_001026747.1.69261 WP_001026747.1.69303 WP_001026747.1.69305 WP_001026747.1.69390 WP_001026747.1.694 WP_001026747.1.69404 WP_001026747.1.69441 WP_001026747.1.6945 WP_001026747.1.69472 WP_001026747.1.69473 WP_001026747.1.69551 WP_001026747.1.69583 WP_001026747.1.69589 WP_001026747.1.69593 WP_001026747.1.69596 WP_001026747.1.69649 WP_001026747.1.69786 WP_001026747.1.69803 WP_001026747.1.69868 WP_001026747.1.69887 WP_001026747.1.6993 WP_001026747.1.69972 WP_001026747.1.70063 WP_001026747.1.70081 WP_001026747.1.70149 WP_001026747.1.70190 WP_001026747.1.70191 WP_001026747.1.70213 WP_001026747.1.70251 WP_001026747.1.70299 WP_001026747.1.70341 WP_001026747.1.70357 WP_001026747.1.70370 WP_001026747.1.70407 WP_001026747.1.70414 WP_001026747.1.70477 WP_001026747.1.70492 WP_001026747.1.7052 WP_001026747.1.70530 WP_001026747.1.70578 WP_001026747.1.70582 WP_001026747.1.70592 WP_001026747.1.70600 WP_001026747.1.70619 WP_001026747.1.70656 WP_001026747.1.70694 WP_001026747.1.70698 WP_001026747.1.70745 WP_001026747.1.70747 WP_001026747.1.70748 WP_001026747.1.70767 WP_001026747.1.70794 WP_001026747.1.70801 WP_001026747.1.70803 WP_001026747.1.70880 WP_001026747.1.7090 WP_001026747.1.70952 WP_001026747.1.70967 WP_001026747.1.71024 WP_001026747.1.71042 WP_001026747.1.71062 WP_001026747.1.71109 WP_001026747.1.71113 WP_001026747.1.71134 WP_001026747.1.71147 WP_001026747.1.71149 WP_001026747.1.71158 WP_001026747.1.71159 WP_001026747.1.71162 WP_001026747.1.71176 WP_001026747.1.71192 WP_001026747.1.71199 WP_001026747.1.71221 WP_001026747.1.71223 WP_001026747.1.71229 WP_001026747.1.71264 WP_001026747.1.71272 WP_001026747.1.71275 WP_001026747.1.71285 WP_001026747.1.71312 WP_001026747.1.71315 WP_001026747.1.71323 WP_001026747.1.71327 WP_001026747.1.71339 WP_001026747.1.71354 WP_001026747.1.71397 WP_001026747.1.71403 WP_001026747.1.71409 WP_001026747.1.71480 WP_001026747.1.71522 WP_001026747.1.71533 WP_001026747.1.71537 WP_001026747.1.71540 WP_001026747.1.71560 WP_001026747.1.71603 WP_001026747.1.71632 WP_001026747.1.71680 WP_001026747.1.71690 WP_001026747.1.71724 WP_001026747.1.71757 WP_001026747.1.71767 WP_001026747.1.71783 WP_001026747.1.71832 WP_001026747.1.71837 WP_001026747.1.71856 WP_001026747.1.71874 WP_001026747.1.7192 WP_001026747.1.71922 WP_001026747.1.71938 WP_001026747.1.71944 WP_001026747.1.71975 WP_001026747.1.71987 WP_001026747.1.71993 WP_001026747.1.71995 WP_001026747.1.72021 WP_001026747.1.72033 WP_001026747.1.7205 WP_001026747.1.72053 WP_001026747.1.72090 WP_001026747.1.7210 WP_001026747.1.72120 WP_001026747.1.72125 WP_001026747.1.72126 WP_001026747.1.72141 WP_001026747.1.72153 WP_001026747.1.72155 WP_001026747.1.72157 WP_001026747.1.72208 WP_001026747.1.72237 WP_001026747.1.72240 WP_001026747.1.7225 WP_001026747.1.72261 WP_001026747.1.72262 WP_001026747.1.72270 WP_001026747.1.72279 WP_001026747.1.72293 WP_001026747.1.72337 WP_001026747.1.72342 WP_001026747.1.72352 WP_001026747.1.72362 WP_001026747.1.72392 WP_001026747.1.72397 WP_001026747.1.72414 WP_001026747.1.72431 WP_001026747.1.72449 WP_001026747.1.72485 WP_001026747.1.72511 WP_001026747.1.72521 WP_001026747.1.72522 WP_001026747.1.72535 WP_001026747.1.72537 WP_001026747.1.72544 WP_001026747.1.72582 WP_001026747.1.72593 WP_001026747.1.72606 WP_001026747.1.72608 WP_001026747.1.72615 WP_001026747.1.72616 WP_001026747.1.72619 WP_001026747.1.72643 WP_001026747.1.72652 WP_001026747.1.72663 WP_001026747.1.72695 WP_001026747.1.72725 WP_001026747.1.72729 WP_001026747.1.72745 WP_001026747.1.72747 WP_001026747.1.72748 WP_001026747.1.72751 WP_001026747.1.72758 WP_001026747.1.72764 WP_001026747.1.7277 WP_001026747.1.72778 WP_001026747.1.72806 WP_001026747.1.72837 WP_001026747.1.72858 WP_001026747.1.72869 WP_001026747.1.72893 WP_001026747.1.72910 WP_001026747.1.72947 WP_001026747.1.72956 WP_001026747.1.72998 WP_001026747.1.73010 WP_001026747.1.73015 WP_001026747.1.73032 WP_001026747.1.73061 WP_001026747.1.7307 WP_001026747.1.73072 WP_001026747.1.73075 WP_001026747.1.73085 WP_001026747.1.73129 WP_001026747.1.73193 WP_001026747.1.73197 WP_001026747.1.73217 WP_001026747.1.73239 WP_001026747.1.73249 WP_001026747.1.73251 WP_001026747.1.73257 WP_001026747.1.73259 WP_001026747.1.73292 WP_001026747.1.73295 WP_001026747.1.73326 WP_001026747.1.73340 WP_001026747.1.73349 WP_001026747.1.73385 WP_001026747.1.73428 WP_001026747.1.73468 WP_001026747.1.7349 WP_001026747.1.73498 WP_001026747.1.73524 WP_001026747.1.73565 WP_001026747.1.73604 WP_001026747.1.73631 WP_001026747.1.73663 WP_001026747.1.73700 WP_001026747.1.73709 WP_001026747.1.73717 WP_001026747.1.73743 WP_001026747.1.7376 WP_001026747.1.73797 WP_001026747.1.73807 WP_001026747.1.73811 WP_001026747.1.73827 WP_001026747.1.73835 WP_001026747.1.73843 WP_001026747.1.73844 WP_001026747.1.73859 WP_001026747.1.73882 WP_001026747.1.73897 WP_001026747.1.73908 WP_001026747.1.73942 WP_001026747.1.73980 WP_001026747.1.73992 WP_001026747.1.73995 WP_001026747.1.73996 WP_001026747.1.74051 WP_001026747.1.74053 WP_001026747.1.7411 WP_001026747.1.74123 WP_001026747.1.7413 WP_001026747.1.74156 WP_001026747.1.74184 WP_001026747.1.74223 WP_001026747.1.7424 WP_001026747.1.74243 WP_001026747.1.7425 WP_001026747.1.74294 WP_001026747.1.74309 WP_001026747.1.74365 WP_001026747.1.74367 WP_001026747.1.74423 WP_001026747.1.74431 WP_001026747.1.74444 WP_001026747.1.74445 WP_001026747.1.74478 WP_001026747.1.74491 WP_001026747.1.74501 WP_001026747.1.74509 WP_001026747.1.74513 WP_001026747.1.74520 WP_001026747.1.74528 WP_001026747.1.74532 WP_001026747.1.7461 WP_001026747.1.74624 WP_001026747.1.74625 WP_001026747.1.74631 WP_001026747.1.74652 WP_001026747.1.74670 WP_001026747.1.74687 WP_001026747.1.74688 WP_001026747.1.74689 WP_001026747.1.74691 WP_001026747.1.74705 WP_001026747.1.74713 WP_001026747.1.74716 WP_001026747.1.74735 WP_001026747.1.7475 WP_001026747.1.74752 WP_001026747.1.7478 WP_001026747.1.7479 WP_001026747.1.74793 WP_001026747.1.74811 WP_001026747.1.74844 WP_001026747.1.74852 WP_001026747.1.74854 WP_001026747.1.74860 WP_001026747.1.74879 WP_001026747.1.74880 WP_001026747.1.74889 WP_001026747.1.74895 WP_001026747.1.74962 WP_001026747.1.74975 WP_001026747.1.74993 WP_001026747.1.74998 WP_001026747.1.75021 WP_001026747.1.75029 WP_001026747.1.75050 WP_001026747.1.75112 WP_001026747.1.75124 WP_001026747.1.75136 WP_001026747.1.75138 WP_001026747.1.75143 WP_001026747.1.75145 WP_001026747.1.75149 WP_001026747.1.75155 WP_001026747.1.75181 WP_001026747.1.75209 WP_001026747.1.75219 WP_001026747.1.75221 WP_001026747.1.75243 WP_001026747.1.75254 WP_001026747.1.75270 WP_001026747.1.75272 WP_001026747.1.75360 WP_001026747.1.75367 WP_001026747.1.75428 WP_001026747.1.75435 WP_001026747.1.75465 WP_001026747.1.75491 WP_001026747.1.75505 WP_001026747.1.75515 WP_001026747.1.75529 WP_001026747.1.75537 WP_001026747.1.75568 WP_001026747.1.75588 WP_001026747.1.75594 WP_001026747.1.75612 WP_001026747.1.75629 WP_001026747.1.75644 WP_001026747.1.75672 WP_001026747.1.75676 WP_001026747.1.75679 WP_001026747.1.75687 WP_001026747.1.75696 WP_001026747.1.75698 WP_001026747.1.75699 WP_001026747.1.75735 WP_001026747.1.75758 WP_001026747.1.75839 WP_001026747.1.75853 WP_001026747.1.75973 WP_001026747.1.75983 WP_001026747.1.75995 WP_001026747.1.75999 WP_001026747.1.76005 WP_001026747.1.76009 WP_001026747.1.7603 WP_001026747.1.76036 WP_001026747.1.76039 WP_001026747.1.76087 WP_001026747.1.76103 WP_001026747.1.76118 WP_001026747.1.76129 WP_001026747.1.76184 WP_001026747.1.76196 WP_001026747.1.76211 WP_001026747.1.76312 WP_001026747.1.76325 WP_001026747.1.76361 WP_001026747.1.76376 WP_001026747.1.76384 WP_001026747.1.76387 WP_001026747.1.76390 WP_001026747.1.76446 WP_001026747.1.76447 WP_001026747.1.76452 WP_001026747.1.76460 WP_001026747.1.76542 WP_001026747.1.76544 WP_001026747.1.76547 WP_001026747.1.76595 WP_001026747.1.7661 WP_001026747.1.76612 WP_001026747.1.76619 WP_001026747.1.76656 WP_001026747.1.76701 WP_001026747.1.76705 WP_001026747.1.76707 WP_001026747.1.76712 WP_001026747.1.7680 WP_001026747.1.76815 WP_001026747.1.76840 WP_001026747.1.76909 WP_001026747.1.76918 WP_001026747.1.76933 WP_001026747.1.76948 WP_001026747.1.76957 WP_001026747.1.76965 WP_001026747.1.76966 WP_001026747.1.7699 WP_001026747.1.77015 WP_001026747.1.77022 WP_001026747.1.77070 WP_001026747.1.77109 WP_001026747.1.77120 WP_001026747.1.77147 WP_001026747.1.77162 WP_001026747.1.77163 WP_001026747.1.77175 WP_001026747.1.77198 WP_001026747.1.77214 WP_001026747.1.77255 WP_001026747.1.77258 WP_001026747.1.7728 WP_001026747.1.77284 WP_001026747.1.77288 WP_001026747.1.77290 WP_001026747.1.77291 WP_001026747.1.7731 WP_001026747.1.77341 WP_001026747.1.77358 WP_001026747.1.77437 WP_001026747.1.77448 WP_001026747.1.77452 WP_001026747.1.77462 WP_001026747.1.77470 WP_001026747.1.77471 WP_001026747.1.77477 WP_001026747.1.77495 WP_001026747.1.775 WP_001026747.1.77503 WP_001026747.1.77542 WP_001026747.1.77551 WP_001026747.1.77581 WP_001026747.1.77595 WP_001026747.1.77608 WP_001026747.1.77626 WP_001026747.1.77636 WP_001026747.1.77648 WP_001026747.1.77725 WP_001026747.1.77741 WP_001026747.1.77767 WP_001026747.1.7781 WP_001026747.1.77813 WP_001026747.1.77826 WP_001026747.1.77833 WP_001026747.1.77876 WP_001026747.1.77929 WP_001026747.1.77949 WP_001026747.1.77999 WP_001026747.1.78000 WP_001026747.1.78007 WP_001026747.1.78041 WP_001026747.1.7808 WP_001026747.1.78089 WP_001026747.1.78097 WP_001026747.1.78099 WP_001026747.1.78102 WP_001026747.1.78131 WP_001026747.1.78188 WP_001026747.1.78196 WP_001026747.1.78202 WP_001026747.1.78235 WP_001026747.1.78321 WP_001026747.1.78323 WP_001026747.1.78337 WP_001026747.1.78368 WP_001026747.1.78377 WP_001026747.1.78390 WP_001026747.1.78445 WP_001026747.1.78453 WP_001026747.1.78462 WP_001026747.1.78481 WP_001026747.1.78515 WP_001026747.1.78523 WP_001026747.1.78527 WP_001026747.1.78553 WP_001026747.1.78583 WP_001026747.1.78586 WP_001026747.1.78610 WP_001026747.1.78612 WP_001026747.1.78645 WP_001026747.1.78683 WP_001026747.1.78687 WP_001026747.1.78696 WP_001026747.1.78698 WP_001026747.1.78706 WP_001026747.1.78718 WP_001026747.1.78746 WP_001026747.1.78750 WP_001026747.1.78757 WP_001026747.1.78775 WP_001026747.1.78791 WP_001026747.1.7883 WP_001026747.1.78843 WP_001026747.1.78854 WP_001026747.1.78888 WP_001026747.1.78891 WP_001026747.1.78919 WP_001026747.1.78953 WP_001026747.1.7896 WP_001026747.1.78966 WP_001026747.1.7898 WP_001026747.1.79004 WP_001026747.1.7901 WP_001026747.1.79065 WP_001026747.1.79067 WP_001026747.1.79075 WP_001026747.1.79086 WP_001026747.1.79088 WP_001026747.1.79092 WP_001026747.1.79226 WP_001026747.1.79246 WP_001026747.1.79306 WP_001026747.1.79312 WP_001026747.1.79343 WP_001026747.1.79346 WP_001026747.1.79356 WP_001026747.1.79369 WP_001026747.1.7937 WP_001026747.1.79464 WP_001026747.1.79478 WP_001026747.1.79519 WP_001026747.1.7952 WP_001026747.1.79525 WP_001026747.1.79526 WP_001026747.1.79540 WP_001026747.1.79558 WP_001026747.1.79591 WP_001026747.1.79606 WP_001026747.1.79640 WP_001026747.1.79685 WP_001026747.1.79713 WP_001026747.1.79764 WP_001026747.1.79800 WP_001026747.1.79816 WP_001026747.1.79824 WP_001026747.1.79840 WP_001026747.1.7985 WP_001026747.1.79869 WP_001026747.1.7987 WP_001026747.1.79877 WP_001026747.1.79905 WP_001026747.1.79922 WP_001026747.1.7993 WP_001026747.1.79930 WP_001026747.1.79932 WP_001026747.1.79936 WP_001026747.1.79944 WP_001026747.1.79984 WP_001026747.1.79995 WP_001026747.1.80011 WP_001026747.1.80043 WP_001026747.1.80050 WP_001026747.1.80060 WP_001026747.1.80061 WP_001026747.1.8007 WP_001026747.1.80071 WP_001026747.1.80106 WP_001026747.1.80112 WP_001026747.1.80136 WP_001026747.1.80141 WP_001026747.1.80176 WP_001026747.1.80179 WP_001026747.1.80183 WP_001026747.1.80255 WP_001026747.1.80292 WP_001026747.1.80310 WP_001026747.1.80320 WP_001026747.1.80388 WP_001026747.1.80426 WP_001026747.1.80428 WP_001026747.1.80440 WP_001026747.1.80444 WP_001026747.1.80463 WP_001026747.1.80484 WP_001026747.1.80517 WP_001026747.1.80524 WP_001026747.1.8057 WP_001026747.1.80612 WP_001026747.1.80626 WP_001026747.1.80662 WP_001026747.1.80666 WP_001026747.1.8068 WP_001026747.1.80709 WP_001026747.1.80724 WP_001026747.1.80731 WP_001026747.1.80736 WP_001026747.1.80737 WP_001026747.1.8074 WP_001026747.1.80753 WP_001026747.1.80754 WP_001026747.1.80756 WP_001026747.1.8076 WP_001026747.1.80789 WP_001026747.1.808 WP_001026747.1.80804 WP_001026747.1.80805 WP_001026747.1.80843 WP_001026747.1.80882 WP_001026747.1.80884 WP_001026747.1.80894 WP_001026747.1.8090 WP_001026747.1.8091 WP_001026747.1.80945 WP_001026747.1.80946 WP_001026747.1.80966 WP_001026747.1.80983 WP_001026747.1.80985 WP_001026747.1.810 WP_001026747.1.81026 WP_001026747.1.81034 WP_001026747.1.81036 WP_001026747.1.81054 WP_001026747.1.81071 WP_001026747.1.81104 WP_001026747.1.81127 WP_001026747.1.81165 WP_001026747.1.81182 WP_001026747.1.8121 WP_001026747.1.81281 WP_001026747.1.81283 WP_001026747.1.81286 WP_001026747.1.8129 WP_001026747.1.81298 WP_001026747.1.81313 WP_001026747.1.81316 WP_001026747.1.81376 WP_001026747.1.81391 WP_001026747.1.81438 WP_001026747.1.81469 WP_001026747.1.81475 WP_001026747.1.81484 WP_001026747.1.81517 WP_001026747.1.81576 WP_001026747.1.81577 WP_001026747.1.81580 WP_001026747.1.81589 WP_001026747.1.81596 WP_001026747.1.81602 WP_001026747.1.81618 WP_001026747.1.81625 WP_001026747.1.81688 WP_001026747.1.81715 WP_001026747.1.8172 WP_001026747.1.81723 WP_001026747.1.81806 WP_001026747.1.81819 WP_001026747.1.81832 WP_001026747.1.81876 WP_001026747.1.81888 WP_001026747.1.81914 WP_001026747.1.81935 WP_001026747.1.81939 WP_001026747.1.81972 WP_001026747.1.82 WP_001026747.1.82032 WP_001026747.1.82059 WP_001026747.1.82061 WP_001026747.1.82062 WP_001026747.1.82074 WP_001026747.1.82095 WP_001026747.1.82137 WP_001026747.1.82217 WP_001026747.1.82239 WP_001026747.1.82240 WP_001026747.1.82242 WP_001026747.1.82246 WP_001026747.1.82275 WP_001026747.1.82280 WP_001026747.1.82316 WP_001026747.1.82320 WP_001026747.1.82326 WP_001026747.1.82330 WP_001026747.1.8235 WP_001026747.1.82378 WP_001026747.1.82439 WP_001026747.1.82485 WP_001026747.1.82499 WP_001026747.1.82507 WP_001026747.1.82536 WP_001026747.1.82572 WP_001026747.1.82614 WP_001026747.1.82626 WP_001026747.1.82691 WP_001026747.1.82700 WP_001026747.1.82715 WP_001026747.1.82718 WP_001026747.1.82754 WP_001026747.1.8277 WP_001026747.1.82780 WP_001026747.1.82784 WP_001026747.1.82799 WP_001026747.1.82831 WP_001026747.1.82853 WP_001026747.1.82902 WP_001026747.1.83020 WP_001026747.1.83033 WP_001026747.1.83035 WP_001026747.1.83051 WP_001026747.1.8306 WP_001026747.1.8308 WP_001026747.1.83093 WP_001026747.1.83097 WP_001026747.1.831 WP_001026747.1.83140 WP_001026747.1.83144 WP_001026747.1.83151 WP_001026747.1.83177 WP_001026747.1.83205 WP_001026747.1.83224 WP_001026747.1.83286 WP_001026747.1.83321 WP_001026747.1.83330 WP_001026747.1.83340 WP_001026747.1.83347 WP_001026747.1.83415 WP_001026747.1.8345 WP_001026747.1.83481 WP_001026747.1.83537 WP_001026747.1.83544 WP_001026747.1.83564 WP_001026747.1.83584 WP_001026747.1.8368 WP_001026747.1.83684 WP_001026747.1.83735 WP_001026747.1.83762 WP_001026747.1.83781 WP_001026747.1.83807 WP_001026747.1.83820 WP_001026747.1.8384 WP_001026747.1.83947 WP_001026747.1.84004 WP_001026747.1.84060 WP_001026747.1.8411 WP_001026747.1.84140 WP_001026747.1.84164 WP_001026747.1.84172 WP_001026747.1.84185 WP_001026747.1.84210 WP_001026747.1.84298 WP_001026747.1.84313 WP_001026747.1.84331 WP_001026747.1.84339 WP_001026747.1.84348 WP_001026747.1.84405 WP_001026747.1.84410 WP_001026747.1.84436 WP_001026747.1.8444 WP_001026747.1.84462 WP_001026747.1.84467 WP_001026747.1.84473 WP_001026747.1.84484 WP_001026747.1.84511 WP_001026747.1.84518 WP_001026747.1.84534 WP_001026747.1.84584 WP_001026747.1.84656 WP_001026747.1.84668 WP_001026747.1.84675 WP_001026747.1.84697 WP_001026747.1.8470 WP_001026747.1.84738 WP_001026747.1.84740 WP_001026747.1.84784 WP_001026747.1.84841 WP_001026747.1.84850 WP_001026747.1.84875 WP_001026747.1.84877 WP_001026747.1.84878 WP_001026747.1.84881 WP_001026747.1.84893 WP_001026747.1.84894 WP_001026747.1.84916 WP_001026747.1.84929 WP_001026747.1.84941 WP_001026747.1.84972 WP_001026747.1.84977 WP_001026747.1.84986 WP_001026747.1.84989 WP_001026747.1.84990 WP_001026747.1.84994 WP_001026747.1.85002 WP_001026747.1.85008 WP_001026747.1.85011 WP_001026747.1.85052 WP_001026747.1.85077 WP_001026747.1.85085 WP_001026747.1.85090 WP_001026747.1.85098 WP_001026747.1.85105 WP_001026747.1.85112 WP_001026747.1.85129 WP_001026747.1.85141 WP_001026747.1.85155 WP_001026747.1.85175 WP_001026747.1.85216 WP_001026747.1.85247 WP_001026747.1.85255 WP_001026747.1.85260 WP_001026747.1.85305 WP_001026747.1.85310 WP_001026747.1.85320 WP_001026747.1.85323 WP_001026747.1.85335 WP_001026747.1.85342 WP_001026747.1.85369 WP_001026747.1.85416 WP_001026747.1.85435 WP_001026747.1.85500 WP_001026747.1.85525 WP_001026747.1.85546 WP_001026747.1.85563 WP_001026747.1.85601 WP_001026747.1.85621 WP_001026747.1.85657 WP_001026747.1.85752 WP_001026747.1.85762 WP_001026747.1.8579 WP_001026747.1.85793 WP_001026747.1.85800 WP_001026747.1.85806 WP_001026747.1.85857 WP_001026747.1.8592 WP_001026747.1.85939 WP_001026747.1.85944 WP_001026747.1.85948 WP_001026747.1.85969 WP_001026747.1.86 WP_001026747.1.86001 WP_001026747.1.86016 WP_001026747.1.86035 WP_001026747.1.8607 WP_001026747.1.86110 WP_001026747.1.86115 WP_001026747.1.86145 WP_001026747.1.86149 WP_001026747.1.86161 WP_001026747.1.86181 WP_001026747.1.86189 WP_001026747.1.8621 WP_001026747.1.86210 WP_001026747.1.86228 WP_001026747.1.86263 WP_001026747.1.86266 WP_001026747.1.86276 WP_001026747.1.86280 WP_001026747.1.86283 WP_001026747.1.86294 WP_001026747.1.86307 WP_001026747.1.8635 WP_001026747.1.86355 WP_001026747.1.86364 WP_001026747.1.86371 WP_001026747.1.86376 WP_001026747.1.86393 WP_001026747.1.86411 WP_001026747.1.86412 WP_001026747.1.86451 WP_001026747.1.86452 WP_001026747.1.86454 WP_001026747.1.86461 WP_001026747.1.86475 WP_001026747.1.86483 WP_001026747.1.86492 WP_001026747.1.8652 WP_001026747.1.86583 WP_001026747.1.86598 WP_001026747.1.86609 WP_001026747.1.86617 WP_001026747.1.86640 WP_001026747.1.86667 WP_001026747.1.86674 WP_001026747.1.86681 WP_001026747.1.86691 WP_001026747.1.86707 WP_001026747.1.86717 WP_001026747.1.86760 WP_001026747.1.86787 WP_001026747.1.86833 WP_001026747.1.86846 WP_001026747.1.86848 WP_001026747.1.8687 WP_001026747.1.86935 WP_001026747.1.86956 WP_001026747.1.86959 WP_001026747.1.86975 WP_001026747.1.86997 WP_001026747.1.87059 WP_001026747.1.87075 WP_001026747.1.87109 WP_001026747.1.8711 WP_001026747.1.87177 WP_001026747.1.87189 WP_001026747.1.87199 WP_001026747.1.87249 WP_001026747.1.87310 WP_001026747.1.87339 WP_001026747.1.87358 WP_001026747.1.87389 WP_001026747.1.87400 WP_001026747.1.87410 WP_001026747.1.87465 WP_001026747.1.87557 WP_001026747.1.87563 WP_001026747.1.87568 WP_001026747.1.87574 WP_001026747.1.87607 WP_001026747.1.87608 WP_001026747.1.87610 WP_001026747.1.87639 WP_001026747.1.87655 WP_001026747.1.87694 WP_001026747.1.87721 WP_001026747.1.87726 WP_001026747.1.87728 WP_001026747.1.87788 WP_001026747.1.87789 WP_001026747.1.87822 WP_001026747.1.87834 WP_001026747.1.87857 WP_001026747.1.87914 WP_001026747.1.87919 WP_001026747.1.87973 WP_001026747.1.87976 WP_001026747.1.87980 WP_001026747.1.87984 WP_001026747.1.87989 WP_001026747.1.880 WP_001026747.1.88017 WP_001026747.1.88020 WP_001026747.1.88088 WP_001026747.1.88110 WP_001026747.1.88149 WP_001026747.1.88155 WP_001026747.1.88189 WP_001026747.1.88238 WP_001026747.1.88252 WP_001026747.1.88285 WP_001026747.1.88301 WP_001026747.1.88304 WP_001026747.1.88352 WP_001026747.1.88376 WP_001026747.1.88379 WP_001026747.1.88384 WP_001026747.1.88413 WP_001026747.1.88427 WP_001026747.1.88434 WP_001026747.1.88462 WP_001026747.1.88535 WP_001026747.1.88539 WP_001026747.1.8854 WP_001026747.1.88557 WP_001026747.1.88598 WP_001026747.1.88603 WP_001026747.1.88607 WP_001026747.1.88631 WP_001026747.1.88646 WP_001026747.1.88667 WP_001026747.1.88678 WP_001026747.1.88685 WP_001026747.1.88709 WP_001026747.1.88710 WP_001026747.1.88711 WP_001026747.1.88717 WP_001026747.1.88720 WP_001026747.1.88732 WP_001026747.1.88735 WP_001026747.1.88757 WP_001026747.1.88759 WP_001026747.1.8879 WP_001026747.1.88834 WP_001026747.1.88950 WP_001026747.1.88961 WP_001026747.1.88997 WP_001026747.1.89050 WP_001026747.1.8906 WP_001026747.1.89067 WP_001026747.1.89090 WP_001026747.1.89097 WP_001026747.1.89099 WP_001026747.1.89111 WP_001026747.1.89165 WP_001026747.1.89183 WP_001026747.1.89197 WP_001026747.1.89200 WP_001026747.1.89255 WP_001026747.1.8928 WP_001026747.1.89305 WP_001026747.1.8938 WP_001026747.1.894 WP_001026747.1.89400 WP_001026747.1.89403 WP_001026747.1.89432 WP_001026747.1.8945 WP_001026747.1.89458 WP_001026747.1.89468 WP_001026747.1.89471 WP_001026747.1.89474 WP_001026747.1.89479 WP_001026747.1.89492 WP_001026747.1.89496 WP_001026747.1.89510 WP_001026747.1.89551 WP_001026747.1.89601 WP_001026747.1.89605 WP_001026747.1.89630 WP_001026747.1.89646 WP_001026747.1.89656 WP_001026747.1.89674 WP_001026747.1.89679 WP_001026747.1.89710 WP_001026747.1.89768 WP_001026747.1.89788 WP_001026747.1.89818 WP_001026747.1.89839 WP_001026747.1.89841 WP_001026747.1.8985 WP_001026747.1.89895 WP_001026747.1.89899 WP_001026747.1.89915 WP_001026747.1.89918 WP_001026747.1.89920 WP_001026747.1.89923 WP_001026747.1.89925 WP_001026747.1.89927 WP_001026747.1.89977 WP_001026747.1.89998 WP_001026747.1.90017 WP_001026747.1.90063 WP_001026747.1.90065 WP_001026747.1.90078 WP_001026747.1.9009 WP_001026747.1.9010 WP_001026747.1.90115 WP_001026747.1.90146 WP_001026747.1.90156 WP_001026747.1.90168 WP_001026747.1.90182 WP_001026747.1.90205 WP_001026747.1.90256 WP_001026747.1.90266 WP_001026747.1.90270 WP_001026747.1.90314 WP_001026747.1.90332 WP_001026747.1.90358 WP_001026747.1.9036 WP_001026747.1.90389 WP_001026747.1.90405 WP_001026747.1.90435 WP_001026747.1.90436 WP_001026747.1.90441 WP_001026747.1.90467 WP_001026747.1.90520 WP_001026747.1.90536 WP_001026747.1.90547 WP_001026747.1.9059 WP_001026747.1.90591 WP_001026747.1.9061 WP_001026747.1.90626 WP_001026747.1.90703 WP_001026747.1.90706 WP_001026747.1.9081 WP_001026747.1.90822 WP_001026747.1.90828 WP_001026747.1.90834 WP_001026747.1.90839 WP_001026747.1.90856 WP_001026747.1.90864 WP_001026747.1.90865 WP_001026747.1.90873 WP_001026747.1.90890 WP_001026747.1.90924 WP_001026747.1.90951 WP_001026747.1.90979 WP_001026747.1.91 WP_001026747.1.91010 WP_001026747.1.91018 WP_001026747.1.91094 WP_001026747.1.91113 WP_001026747.1.91117 WP_001026747.1.91121 WP_001026747.1.91170 WP_001026747.1.9118 WP_001026747.1.91213 WP_001026747.1.91266 WP_001026747.1.91268 WP_001026747.1.91277 WP_001026747.1.91290 WP_001026747.1.91340 WP_001026747.1.91341 WP_001026747.1.91397 WP_001026747.1.91414 WP_001026747.1.91445 WP_001026747.1.91462 WP_001026747.1.91485 WP_001026747.1.915 WP_001026747.1.91511 WP_001026747.1.91551 WP_001026747.1.91565 WP_001026747.1.9157 WP_001026747.1.91594 WP_001026747.1.91596 WP_001026747.1.9160 WP_001026747.1.91626 WP_001026747.1.91630 WP_001026747.1.91640 WP_001026747.1.91643 WP_001026747.1.91644 WP_001026747.1.91672 WP_001026747.1.91685 WP_001026747.1.9169 WP_001026747.1.9171 WP_001026747.1.91739 WP_001026747.1.91777 WP_001026747.1.91779 WP_001026747.1.91787 WP_001026747.1.9185 WP_001026747.1.91850 WP_001026747.1.91863 WP_001026747.1.91879 WP_001026747.1.91951 WP_001026747.1.91959 WP_001026747.1.91971 WP_001026747.1.91994 WP_001026747.1.92014 WP_001026747.1.92019 WP_001026747.1.92031 WP_001026747.1.92048 WP_001026747.1.92058 WP_001026747.1.921 WP_001026747.1.92102 WP_001026747.1.92114 WP_001026747.1.92123 WP_001026747.1.92161 WP_001026747.1.92163 WP_001026747.1.92180 WP_001026747.1.92195 WP_001026747.1.92215 WP_001026747.1.92311 WP_001026747.1.92323 WP_001026747.1.92361 WP_001026747.1.924 WP_001026747.1.92434 WP_001026747.1.92473 WP_001026747.1.92496 WP_001026747.1.92532 WP_001026747.1.92535 WP_001026747.1.9255 WP_001026747.1.92568 WP_001026747.1.92571 WP_001026747.1.92577 WP_001026747.1.92614 WP_001026747.1.92615 WP_001026747.1.9264 WP_001026747.1.9266 WP_001026747.1.92668 WP_001026747.1.92693 WP_001026747.1.92708 WP_001026747.1.92719 WP_001026747.1.92742 WP_001026747.1.92780 WP_001026747.1.92781 WP_001026747.1.92792 WP_001026747.1.92796 WP_001026747.1.92845 WP_001026747.1.92865 WP_001026747.1.92932 WP_001026747.1.92943 WP_001026747.1.92953 WP_001026747.1.92989 WP_001026747.1.93005 WP_001026747.1.93016 WP_001026747.1.93019 WP_001026747.1.93023 WP_001026747.1.93033 WP_001026747.1.93048 WP_001026747.1.93054 WP_001026747.1.93072 WP_001026747.1.93085 WP_001026747.1.93100 WP_001026747.1.93133 WP_001026747.1.93150 WP_001026747.1.93175 WP_001026747.1.93252 WP_001026747.1.93276 WP_001026747.1.93309 WP_001026747.1.93312 WP_001026747.1.93338 WP_001026747.1.93379 WP_001026747.1.93388 WP_001026747.1.93463 WP_001026747.1.93509 WP_001026747.1.93531 WP_001026747.1.93569 WP_001026747.1.93605 WP_001026747.1.93621 WP_001026747.1.93626 WP_001026747.1.93629 WP_001026747.1.93652 WP_001026747.1.93665 WP_001026747.1.93673 WP_001026747.1.93733 WP_001026747.1.93743 WP_001026747.1.93745 WP_001026747.1.93755 WP_001026747.1.93768 WP_001026747.1.938 WP_001026747.1.93800 WP_001026747.1.93873 WP_001026747.1.93877 WP_001026747.1.939 WP_001026747.1.93900 WP_001026747.1.93911 WP_001026747.1.93918 WP_001026747.1.93921 WP_001026747.1.93951 WP_001026747.1.93971 WP_001026747.1.94008 WP_001026747.1.94011 WP_001026747.1.94025 WP_001026747.1.94057 WP_001026747.1.94156 WP_001026747.1.9416 WP_001026747.1.94187 WP_001026747.1.94232 WP_001026747.1.94271 WP_001026747.1.94298 WP_001026747.1.94317 WP_001026747.1.94353 WP_001026747.1.94388 WP_001026747.1.94404 WP_001026747.1.94429 WP_001026747.1.94445 WP_001026747.1.94468 WP_001026747.1.94475 WP_001026747.1.94507 WP_001026747.1.94516 WP_001026747.1.94542 WP_001026747.1.94548 WP_001026747.1.9457 WP_001026747.1.94578 WP_001026747.1.94580 WP_001026747.1.94626 WP_001026747.1.94690 WP_001026747.1.94692 WP_001026747.1.94695 WP_001026747.1.94727 WP_001026747.1.94738 WP_001026747.1.94739 WP_001026747.1.94753 WP_001026747.1.94754 WP_001026747.1.94764 WP_001026747.1.94787 WP_001026747.1.948 WP_001026747.1.94801 WP_001026747.1.94806 WP_001026747.1.94808 WP_001026747.1.94822 WP_001026747.1.94880 WP_001026747.1.94889 WP_001026747.1.9489 WP_001026747.1.94898 WP_001026747.1.949 WP_001026747.1.94903 WP_001026747.1.9491 WP_001026747.1.94927 WP_001026747.1.94935 WP_001026747.1.94938 WP_001026747.1.94949 WP_001026747.1.94963 WP_001026747.1.94993 WP_001026747.1.95005 WP_001026747.1.95022 WP_001026747.1.95037 WP_001026747.1.95062 WP_001026747.1.95080 WP_001026747.1.9513 WP_001026747.1.95161 WP_001026747.1.95198 WP_001026747.1.95233 WP_001026747.1.95243 WP_001026747.1.95254 WP_001026747.1.95332 WP_001026747.1.95368 WP_001026747.1.95381 WP_001026747.1.95390 WP_001026747.1.95395 WP_001026747.1.95400 WP_001026747.1.95403 WP_001026747.1.95424 WP_001026747.1.95438 WP_001026747.1.95490 WP_001026747.1.95518 WP_001026747.1.95521 WP_001026747.1.95563 WP_001026747.1.9559 WP_001026747.1.95595 WP_001026747.1.95596 WP_001026747.1.95604 WP_001026747.1.95611 WP_001026747.1.95655 WP_001026747.1.95712 WP_001026747.1.95771 WP_001026747.1.95800 WP_001026747.1.95801 WP_001026747.1.95821 WP_001026747.1.95824 WP_001026747.1.95827 WP_001026747.1.95835 WP_001026747.1.95846 WP_001026747.1.95849 WP_001026747.1.95865 WP_001026747.1.95869 WP_001026747.1.95916 WP_001026747.1.95919 WP_001026747.1.95931 WP_001026747.1.95932 WP_001026747.1.960 WP_001026747.1.96015 WP_001026747.1.96053 WP_001026747.1.96059 WP_001026747.1.96066 WP_001026747.1.96086 WP_001026747.1.96114 WP_001026747.1.96128 WP_001026747.1.96177 WP_001026747.1.96215 WP_001026747.1.96222 WP_001026747.1.96229 WP_001026747.1.96247 WP_001026747.1.96278 WP_001026747.1.96279 WP_001026747.1.96281 WP_001026747.1.96290 WP_001026747.1.96293 WP_001026747.1.96299 WP_001026747.1.96303 WP_001026747.1.9631 WP_001026747.1.96341 WP_001026747.1.96417 WP_001026747.1.96457 WP_001026747.1.96479 WP_001026747.1.96484 WP_001026747.1.96494 WP_001026747.1.965 WP_001026747.1.96541 WP_001026747.1.96562 WP_001026747.1.9657 WP_001026747.1.96585 WP_001026747.1.96608 WP_001026747.1.96609 WP_001026747.1.9661 WP_001026747.1.96617 WP_001026747.1.96659 WP_001026747.1.96680 WP_001026747.1.96683 WP_001026747.1.96701 WP_001026747.1.96743 WP_001026747.1.96753 WP_001026747.1.96769 WP_001026747.1.96779 WP_001026747.1.96817 WP_001026747.1.96850 WP_001026747.1.9690 WP_001026747.1.9691 WP_001026747.1.96924 WP_001026747.1.96932 WP_001026747.1.96936 WP_001026747.1.96944 WP_001026747.1.96984 WP_001026747.1.96989 WP_001026747.1.97011 WP_001026747.1.97027 WP_001026747.1.97049 WP_001026747.1.97059 WP_001026747.1.9708 WP_001026747.1.97119 WP_001026747.1.97123 WP_001026747.1.97160 WP_001026747.1.97200 WP_001026747.1.97231 WP_001026747.1.97238 WP_001026747.1.97247 WP_001026747.1.97248 WP_001026747.1.97279 WP_001026747.1.97344 WP_001026747.1.97356 WP_001026747.1.97360 WP_001026747.1.97361 WP_001026747.1.97379 WP_001026747.1.97418 WP_001026747.1.97421 WP_001026747.1.97434 WP_001026747.1.97439 WP_001026747.1.97459 WP_001026747.1.9747 WP_001026747.1.97502 WP_001026747.1.97538 WP_001026747.1.97544 WP_001026747.1.97560 WP_001026747.1.97667 WP_001026747.1.97675 WP_001026747.1.97677 WP_001026747.1.97685 WP_001026747.1.97705 WP_001026747.1.97775 WP_001026747.1.97798 WP_001026747.1.97815 WP_001026747.1.97822 WP_001026747.1.97825 WP_001026747.1.97930 WP_001026747.1.97932 WP_001026747.1.97937 WP_001026747.1.97962 WP_001026747.1.97982 WP_001026747.1.97996 WP_001026747.1.98000 WP_001026747.1.98012 WP_001026747.1.98026 WP_001026747.1.9803 WP_001026747.1.98082 WP_001026747.1.98115 WP_001026747.1.98139 WP_001026747.1.9816 WP_001026747.1.9817 WP_001026747.1.98208 WP_001026747.1.98220 WP_001026747.1.98232 WP_001026747.1.98235 WP_001026747.1.98239 WP_001026747.1.98241 WP_001026747.1.98244 WP_001026747.1.98292 WP_001026747.1.98294 WP_001026747.1.98301 WP_001026747.1.98323 WP_001026747.1.98355 WP_001026747.1.98357 WP_001026747.1.98400 WP_001026747.1.98424 WP_001026747.1.98429 WP_001026747.1.9844 WP_001026747.1.98442 WP_001026747.1.98451 WP_001026747.1.98477 WP_001026747.1.98549 WP_001026747.1.98578 WP_001026747.1.9858 WP_001026747.1.98614 WP_001026747.1.98626 WP_001026747.1.98628 WP_001026747.1.9864 WP_001026747.1.98654 WP_001026747.1.98665 WP_001026747.1.98668 WP_001026747.1.98683 WP_001026747.1.98702 WP_001026747.1.98776 WP_001026747.1.98795 WP_001026747.1.98849 WP_001026747.1.98875 WP_001026747.1.98886 WP_001026747.1.98908 WP_001026747.1.98976 WP_001026747.1.98988 WP_001026747.1.99029 WP_001026747.1.99046 WP_001026747.1.99110 WP_001026747.1.99119 WP_001026747.1.99168 WP_001026747.1.99209 WP_001026747.1.99246 WP_001026747.1.99289 WP_001026747.1.99295 WP_001026747.1.99302 WP_001026747.1.99304 WP_001026747.1.99310 WP_001026747.1.99319 WP_001026747.1.99334 WP_001026747.1.99345 WP_001026747.1.99361 WP_001026747.1.99392 WP_001026747.1.9940 WP_001026747.1.99400 WP_001026747.1.99446 WP_001026747.1.99453 WP_001026747.1.99471 WP_001026747.1.99475 WP_001026747.1.99486 WP_001026747.1.99511 WP_001026747.1.99534 WP_001026747.1.99562 WP_001026747.1.99592 WP_001026747.1.99602 WP_001026747.1.99603 WP_001026747.1.99619 WP_001026747.1.99632 WP_001026747.1.99666 WP_001026747.1.99774 WP_001026747.1.99804 WP_001026747.1.99827 WP_001026747.1.99869 WP_001026747.1.99929 YP_006780482.1.12065 gi|30061987|ref|NP_836158.1| gi|218547942|ref|YP_002381733.1| gi|443616514|ref|YP_007380370.1| gi|16128471|ref|NP_415020.1| gi|251783995|ref|YP_002998299.1| gi|386612684|ref|YP_006132350.1| gi|157160016|ref|YP_001457334.1| gi|387611011|ref|YP_006114127.1| gi|187731718|ref|YP_001879199.1| gi|384542042|ref|YP_005726103.1| gi|387620245|ref|YP_006127872.1| gi|238899774|ref|YP_002925570.1| gi|260853710|ref|YP_003227601.1| gi|209917703|ref|YP_002291787.1| gi|24111870|ref|NP_706380.1| gi|218553053|ref|YP_002385966.1| gi|387606000|ref|YP_006094856.1| gi|260866648|ref|YP_003233050.1| gi|407483333|ref|YP_006780482.1| gi|383177083|ref|YP_005455088.1| 1q06A gi|218693949|ref|YP_002401616.1| gi|386708289|ref|YP_006172010.1| gi|378714108|ref|YP_005279001.1| APC241 gi|170021125|ref|YP_001726079.1| gi|170080072|ref|YP_001729392.1| cath|current|1q05A00/1-127 cath|current|1q05B00/1-128 cath|current|1q06A00/1-127 cath|current|1q06B00/1-127 cath|current|1q07A00/1-127 cath|current|1q07B00/1-127 gi|407467936|ref|YP_006785622.1| gi|386708289|ref|YP_006172010.1| 1q05_A 1q05_B 1q06_A 1q06_B 1q07_A 1q07_B 4wlw_A gi|410483885|ref|YP_006771431.1| 198214.SF0432 198215.S0439 300268.SBO_0389 300269.SSON_0476 316385.ECDH10B_0444 316407.cueR 331111.EcE24377A_0526 331112.EcHS_A0566 344609.SbBS512_E0422 409438.ECSE_0512 413997.ECB_00438 469008.ECBD_3169 481805.EcolC_3129 511145.b0487 573235.ECO26_0522 585034.ECIAI1_0490 585054.EFER_0545 585055.EC55989_0500 585395.ECO103_0463 585396.ECO111_0522 595496.BWG_0368 gi|74311068|ref|YP_309487.1| gi|82542981|ref|YP_406928.1| gi|544389314|ref|YP_008563696.1| gi|260842687|ref|YP_003220465.1| gi|157157213|ref|YP_001461676.1| gi|387620245|ref|YP_006127872.1| gi|254160556|ref|YP_003043664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]