SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1q1aA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1q1aA
Domain Number 1 Region: 22-282
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.01e-96
Family Sir2 family of transcriptional regulators 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1q1aA   PDB: 1q1a   SUPERFAMILY: 1q1aA
Sequence length 289
Comment (A:)
Sequence
tastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlarlklpype
avfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqnidtlerqa
gvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelvkpaivff
gedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfaslpeeiprkvkr
vlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekilta
Download sequence
Identical sequences d1q1aa_ 1q1aA 1q1a_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]