SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1q77A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1q77A
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.53e-87
Family Universal stress protein-like 0.000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1q77A   PDB: 1q77   SUPERFAMILY: 1q77A
Sequence length 138
Comment (A:)
Sequence
snamkvllvltdaysdcekaityavnfseklgaeldilavledvynleranvtfglpfpp
eikeeskkrierrlrevwekltgsteipgveyrigplseevkkfvegkgyelvvwacyps
aylckvidglnlaslivk
Download sequence
Identical sequences 1q77_A 1q77_B 1q77A 000009856|e1q77A1|2005.1.1.149|A:1-138 000103447|e1q77B1|2005.1.1.149|B:1-138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]