SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1q8lA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1q8lA
Domain Number 1 Region: 13-74
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.17e-30
Family HMA, heavy metal-associated domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1q8lA   PDB: 1q8l   SUPERFAMILY: 1q8lA
Sequence length 84
Comment (A:)
Sequence
gsmaqagevvlkmkvegmtchsctstiegkigklqgvqrikvsldnqeativyqphlisv
eemkkqieamgfpafvkkqpkylk
Download sequence
Identical sequences 000005142|e1q8lA1|304.3.1.7|A:1-84 cath|current|1q8lA00/1-84 1q8l_A 1q8lA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]