SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1q9uA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1q9uA
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily TT1751-like 1.46e-37
Family TT1751-like 0.000000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1q9uA   PDB: 1q9u   SUPERFAMILY: 1q9uA
Sequence length 130
Comment (A:)
Sequence
snamfhytvdvstgmnetierleeslkqegfgvlwqfsvteklqekgldfstpmvilevc
npqeaarvlnenllvgyflpcklvvyqengttkigmpkptmlvgmmndpalkeiaadiek
rlaacldrcr
Download sequence
Identical sequences 1q9uA 1q9u_A 1q9u_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]