SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qa2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qa2A
Domain Number 1 Region: 1-554
Classification Level Classification E-value
Superfamily Pectin lyase-like 0
Family P22 tailspike protein 0.000000000000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qa2A   PDB: 1qa2   SUPERFAMILY: 1qa2A
Sequence length 554
Comment (A:)
Sequence
ysieadkkfkysvklsdyptlqdaasaavdgllidrdynfyggetvdfggkvltieckak
figdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqsktdgy
qptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgchfckm
vdannpsggkdgiitfenlsgdwgkgnyviggrtsygsvssvqflrnnggferdggvigf
tsyragesgvktwqgtvgsttsrnynlqfrdsvviypvwdgfdlgadtdmnpeldrpgdy
pitqyplhqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllthesvf
tniaiidtntkdfqanqiyisgacrvnglrligirstdgqgltidapnstvsgitgmvdp
srinvanlaeeglgniransfgydsaaiklrihklsktldsgalyshinggagsgsaytq
ltaisgstpdavslkvnhkdcrgaeipfvpdiasddfikdsscflpywennstslkalvk
kpngelvrltlatl
Download sequence
Identical sequences cath|current|1qa2A00/113-666 d1qa2a_ 1qa2A 1qa2_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]