SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qd5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qd5A
Domain Number 1 Region: 25-274
Classification Level Classification E-value
Superfamily Outer membrane phospholipase A (OMPLA) 2.56e-92
Family Outer membrane phospholipase A (OMPLA) 0.000000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qd5A   PDB: 1qd5   SUPERFAMILY: 1qd5A
Sequence length 275
Comment (A:)
Sequence
arirapqeatvkevhdapavrgsiianmlqehdnpftlypydtnyliytqtsdlnkeaia
sydwaenarkdevkfqlslafplwrgilgpnsvlgasytqkswwqlsnseesspfretny
epqlflgfatdyrfagwtlrdvemgynhdsngrsdptsrswnrlytrlmaengnwlvevk
pwyvvgntddnpditkymgyyqlkigyhlgdavlsakgqynwntgyggaelglsypitkh
vrlytqvysgygeslidynfnqtrvgvgvmlndlf
Download sequence
Identical sequences 1fw2_A 1fw3_A 1fw3_B 1qd5_A 1qd5A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]