SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qd6C from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qd6C
Domain Number 1 Region: 1-239
Classification Level Classification E-value
Superfamily Outer membrane phospholipase A (OMPLA) 3.66e-90
Family Outer membrane phospholipase A (OMPLA) 0.000000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qd6C   PDB: 1qd6
Sequence length 240
Comment (C:)
Sequence
ftlypydtnyliytqtsdlnkeaiasydwaenarkdevkfqlslafplwrgilgpnsvlg
asytqkswwqlsnseesspfretnyepqlflgfatdyrfagwtlrdvemgynhdsngrsd
ptsrswnrlytrlmaengnwlvevkpwyvvgntddnpditkymgyyqlkigyhlgdavls
akgqynwntgyggaelglsypitkhvrlytqvysgygeslidynfnqtrvgvgvmlndlf
Download sequence
Identical sequences cath|current|1qd6C00/30-269 cath|current|1qd6D00/31-269 1qd6_C 1qd6_D 1qd6C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]