SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qe0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qe0A
Domain Number 1 Region: 1-319
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.07e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000126
Further Details:      
 
Domain Number 2 Region: 329-420
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.73e-26
Family Anticodon-binding domain of Class II aaRS 0.00000703
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qe0A   PDB: 1qe0
Sequence length 420
Comment (A:)
Sequence
mikiprgtqdilpedskkwryienqldelmtfynykeirtpifestdlfargvgdstdvv
qkemytfkdkgdrsitlrpegtaavvrsyiehkmqgnpnqpiklyyngpmfryerkqkgr
yrqfnqfgveaigaenpsvdaevlamvmhiyqsfglkhlklvinsvgdmasrkeynealv
khfepvihefcsdcqsrlhtdpmrildckvdrdkeaiktapritdflneeskayyeqvka
ylddlgipytedpnlvrgldyythtafelmmdnpnydgaittlcgggryngllelldgps
etgigfalsierlllaleeegieldieenldlfivtmgdqadryavkllnhlrhngikad
kdylqrkikgqmkqadrlgakftivigdqelennkidvknmttgesetieldalveyfkk
Download sequence
Identical sequences 1qe0_A 1qe0_B 1qe0A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]