SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qf6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qf6A
Domain Number 1 Region: 241-531
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.02e-210
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000278
Further Details:      
 
Domain Number 2 Region: 63-241
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.83e-65
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000000111
Further Details:      
 
Domain Number 3 Region: 533-628
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.98e-57
Family Anticodon-binding domain of Class II aaRS 0.0000181
Further Details:      
 
Domain Number 4 Region: 3-61
Classification Level Classification E-value
Superfamily TGS-like 1.23e-16
Family TGS domain 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qf6A   PDB: 1qf6
Sequence length 642
Comment (A:)
Sequence
MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSII
TAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEAL
EKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVD
MCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWADKKALNAYLQRLEEAA
KRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMD
RVLWEKTGHWDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGS
CHRNEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKL
STRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQC
GTVQLDFSLPSRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAGFFPTWLAPV
QVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKE
VESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE
Download sequence
Identical sequences A0A062Y981 A0A064TP07 A0A070F2I9 A0A070SSY2 A0A073HGP5 A0A073UT66 A0A0A0FD60 A0A0E0V5T9 A0A0E1LXV1 A0A0E1SZI4 A0A0E2L472 A0A0F6MDX5 A0A0G3K9L1 A0A0I2K9H8 A0A0K9T9L3 A0A0M7NPJ0 A0A127GKG7 A0A140N7E6 A0A142H3G0 A0A181WRU4 A0A1E2VLN7 A0A1E3N086 A0A1S9KG68 A0A1W2MN08 A0A1X3I6T4 A0A1X3IYU1 A0A1X3JG09 A0A1X3KBP4 A0A1X3LKA6 A0A1X3LYQ0 A0A236Q338 A0A2D0P6S7 A1ABQ2 B1LE12 B1XGI1 B3X6W2 B7MAS9 B7MVJ7 B7N556 B7NT58 B7USA2 C4ZYI1 D2AFJ8 D3GVD3 D6IB33 D6JB56 D7Z816 D8AB51 E2QMS9 E3PNA3 E3XNT4 E7SVY2 E9XJC6 F4SK60 F4TF42 F5N2V7 F5NUR0 G0F554 H4IBK1 H4ISG0 H4J8Q7 H4KHJ1 H4LCF5 H4UJS4 I2S344 I2W6V5 I2XET4 I4SES1 L2XM52 L3CCB4 L3P3X9 L3QL22 L4J874 L4VI21 P0A8M3 P0A8M4 P0A8M5 Q0T4S9 Q0THB0 Q1RB76 Q3Z267 S0VIK0 S1D7N3 S1HGU9 S1IK59 S1Q2E8 T5UX48 T6AM03 T6HDN0 T6MR08 T9E6X3 U9YCQ2 U9YZ27 V0S4V8 V0VJS0 V0YLC3 V0YVV8 V2TE63 V8KEY8 W1B1C9
gi|387621436|ref|YP_006129063.1| gi|117623893|ref|YP_852806.1| gi|26247970|ref|NP_754010.1| gi|24112885|ref|NP_707395.1| gi|30063014|ref|NP_837185.1| gi|170680212|ref|YP_001743530.1| gi|388477793|ref|YP_489981.1| gi|254161779|ref|YP_003044887.1| gi|386624342|ref|YP_006144070.1| gi|386639248|ref|YP_006106046.1| gi|218705218|ref|YP_002412737.1| gi|16129675|ref|NP_416234.1| gi|238900934|ref|YP_002926730.1| gi|218689663|ref|YP_002397875.1| gi|170081377|ref|YP_001730697.1| gi|387607339|ref|YP_006096195.1| gi|384543132|ref|YP_005727194.1| gi|386629411|ref|YP_006149131.1| gi|387612206|ref|YP_006115322.1| gi|110805471|ref|YP_688991.1| gi|387621436|ref|YP_006129063.1| gi|386634331|ref|YP_006154050.1| gi|386599518|ref|YP_006101024.1| gi|471333561|ref|YP_007557038.1| gi|74311961|ref|YP_310380.1| IGBMC-0158-000 gi|110641840|ref|YP_669570.1| gi|215486938|ref|YP_002329369.1| gi|251785169|ref|YP_002999473.1| gi|386604310|ref|YP_006110610.1| gi|218558588|ref|YP_002391501.1| 1qf6A gi|544576144|ref|YP_008571668.1| 1qf6_A gi|251785169|ref|YP_002999473.1| gi|91210933|ref|YP_540919.1| gi|218699714|ref|YP_002407343.1| NP_416234.1.90541 NP_707395.1.23235 WP_001144202.1.100052 WP_001144202.1.100063 WP_001144202.1.100085 WP_001144202.1.100111 WP_001144202.1.100135 WP_001144202.1.100138 WP_001144202.1.100151 WP_001144202.1.100194 WP_001144202.1.100220 WP_001144202.1.100251 WP_001144202.1.100306 WP_001144202.1.100315 WP_001144202.1.10034 WP_001144202.1.100389 WP_001144202.1.100441 WP_001144202.1.100448 WP_001144202.1.10048 WP_001144202.1.100487 WP_001144202.1.10051 WP_001144202.1.100531 WP_001144202.1.100685 WP_001144202.1.100688 WP_001144202.1.100725 WP_001144202.1.100735 WP_001144202.1.100738 WP_001144202.1.100824 WP_001144202.1.100851 WP_001144202.1.100852 WP_001144202.1.100898 WP_001144202.1.100916 WP_001144202.1.100950 WP_001144202.1.100959 WP_001144202.1.100966 WP_001144202.1.10100 WP_001144202.1.101033 WP_001144202.1.101052 WP_001144202.1.1011 WP_001144202.1.101110 WP_001144202.1.101121 WP_001144202.1.101152 WP_001144202.1.101158 WP_001144202.1.101175 WP_001144202.1.101186 WP_001144202.1.101214 WP_001144202.1.10131 WP_001144202.1.101313 WP_001144202.1.10138 WP_001144202.1.101418 WP_001144202.1.101423 WP_001144202.1.101429 WP_001144202.1.101439 WP_001144202.1.101445 WP_001144202.1.101486 WP_001144202.1.101522 WP_001144202.1.101545 WP_001144202.1.101586 WP_001144202.1.101594 WP_001144202.1.101654 WP_001144202.1.101667 WP_001144202.1.101693 WP_001144202.1.101694 WP_001144202.1.101700 WP_001144202.1.101727 WP_001144202.1.101747 WP_001144202.1.101769 WP_001144202.1.10188 WP_001144202.1.101887 WP_001144202.1.101889 WP_001144202.1.101926 WP_001144202.1.101937 WP_001144202.1.101940 WP_001144202.1.101942 WP_001144202.1.101948 WP_001144202.1.101964 WP_001144202.1.101984 WP_001144202.1.102021 WP_001144202.1.102076 WP_001144202.1.102093 WP_001144202.1.102106 WP_001144202.1.102144 WP_001144202.1.10222 WP_001144202.1.10226 WP_001144202.1.10252 WP_001144202.1.10304 WP_001144202.1.10326 WP_001144202.1.10329 WP_001144202.1.10348 WP_001144202.1.10352 WP_001144202.1.10361 WP_001144202.1.10381 WP_001144202.1.1040 WP_001144202.1.10417 WP_001144202.1.10491 WP_001144202.1.10492 WP_001144202.1.10496 WP_001144202.1.10508 WP_001144202.1.10525 WP_001144202.1.10569 WP_001144202.1.10576 WP_001144202.1.1058 WP_001144202.1.10605 WP_001144202.1.10628 WP_001144202.1.10697 WP_001144202.1.10705 WP_001144202.1.10715 WP_001144202.1.10744 WP_001144202.1.10771 WP_001144202.1.10786 WP_001144202.1.10787 WP_001144202.1.10814 WP_001144202.1.10833 WP_001144202.1.10862 WP_001144202.1.10869 WP_001144202.1.10995 WP_001144202.1.11047 WP_001144202.1.11057 WP_001144202.1.11113 WP_001144202.1.11118 WP_001144202.1.1113 WP_001144202.1.11217 WP_001144202.1.11241 WP_001144202.1.11250 WP_001144202.1.11251 WP_001144202.1.11265 WP_001144202.1.11272 WP_001144202.1.11285 WP_001144202.1.11323 WP_001144202.1.11408 WP_001144202.1.11411 WP_001144202.1.11437 WP_001144202.1.11440 WP_001144202.1.11452 WP_001144202.1.11467 WP_001144202.1.11499 WP_001144202.1.11531 WP_001144202.1.11575 WP_001144202.1.11595 WP_001144202.1.11608 WP_001144202.1.11673 WP_001144202.1.1176 WP_001144202.1.11762 WP_001144202.1.11803 WP_001144202.1.11844 WP_001144202.1.11912 WP_001144202.1.11955 WP_001144202.1.11956 WP_001144202.1.11982 WP_001144202.1.12000 WP_001144202.1.12009 WP_001144202.1.12010 WP_001144202.1.12036 WP_001144202.1.12050 WP_001144202.1.12060 WP_001144202.1.12076 WP_001144202.1.12095 WP_001144202.1.12111 WP_001144202.1.12112 WP_001144202.1.1212 WP_001144202.1.1218 WP_001144202.1.12204 WP_001144202.1.12230 WP_001144202.1.12268 WP_001144202.1.12292 WP_001144202.1.12295 WP_001144202.1.12319 WP_001144202.1.12352 WP_001144202.1.12415 WP_001144202.1.1242 WP_001144202.1.12426 WP_001144202.1.12459 WP_001144202.1.12542 WP_001144202.1.12558 WP_001144202.1.12574 WP_001144202.1.12582 WP_001144202.1.12646 WP_001144202.1.12675 WP_001144202.1.12679 WP_001144202.1.12680 WP_001144202.1.12697 WP_001144202.1.12709 WP_001144202.1.12756 WP_001144202.1.12761 WP_001144202.1.12763 WP_001144202.1.1278 WP_001144202.1.1280 WP_001144202.1.12826 WP_001144202.1.12893 WP_001144202.1.12914 WP_001144202.1.12915 WP_001144202.1.12917 WP_001144202.1.12944 WP_001144202.1.12965 WP_001144202.1.13002 WP_001144202.1.13031 WP_001144202.1.1308 WP_001144202.1.1312 WP_001144202.1.13136 WP_001144202.1.1314 WP_001144202.1.13157 WP_001144202.1.13176 WP_001144202.1.13205 WP_001144202.1.1323 WP_001144202.1.13239 WP_001144202.1.13271 WP_001144202.1.13272 WP_001144202.1.13281 WP_001144202.1.13295 WP_001144202.1.13333 WP_001144202.1.13346 WP_001144202.1.13383 WP_001144202.1.13393 WP_001144202.1.13409 WP_001144202.1.13411 WP_001144202.1.1343 WP_001144202.1.1345 WP_001144202.1.13451 WP_001144202.1.13469 WP_001144202.1.13473 WP_001144202.1.13566 WP_001144202.1.13585 WP_001144202.1.13589 WP_001144202.1.13618 WP_001144202.1.13626 WP_001144202.1.13662 WP_001144202.1.13672 WP_001144202.1.13740 WP_001144202.1.13778 WP_001144202.1.13877 WP_001144202.1.13891 WP_001144202.1.13949 WP_001144202.1.13981 WP_001144202.1.14023 WP_001144202.1.14042 WP_001144202.1.14094 WP_001144202.1.14127 WP_001144202.1.14144 WP_001144202.1.14154 WP_001144202.1.14164 WP_001144202.1.14199 WP_001144202.1.142 WP_001144202.1.14245 WP_001144202.1.14299 WP_001144202.1.14322 WP_001144202.1.14331 WP_001144202.1.14346 WP_001144202.1.14371 WP_001144202.1.1438 WP_001144202.1.14389 WP_001144202.1.14432 WP_001144202.1.14445 WP_001144202.1.14451 WP_001144202.1.14468 WP_001144202.1.14499 WP_001144202.1.14501 WP_001144202.1.14509 WP_001144202.1.14529 WP_001144202.1.14538 WP_001144202.1.14600 WP_001144202.1.14605 WP_001144202.1.14607 WP_001144202.1.1461 WP_001144202.1.14616 WP_001144202.1.14648 WP_001144202.1.1470 WP_001144202.1.14711 WP_001144202.1.14712 WP_001144202.1.14746 WP_001144202.1.14749 WP_001144202.1.14811 WP_001144202.1.14833 WP_001144202.1.1486 WP_001144202.1.14861 WP_001144202.1.14871 WP_001144202.1.14914 WP_001144202.1.14934 WP_001144202.1.14946 WP_001144202.1.14958 WP_001144202.1.14963 WP_001144202.1.14965 WP_001144202.1.15007 WP_001144202.1.15020 WP_001144202.1.1508 WP_001144202.1.15090 WP_001144202.1.1512 WP_001144202.1.15121 WP_001144202.1.15148 WP_001144202.1.15191 WP_001144202.1.15207 WP_001144202.1.15245 WP_001144202.1.15252 WP_001144202.1.15259 WP_001144202.1.15274 WP_001144202.1.15287 WP_001144202.1.15347 WP_001144202.1.15464 WP_001144202.1.15496 WP_001144202.1.1550 WP_001144202.1.15538 WP_001144202.1.15565 WP_001144202.1.15576 WP_001144202.1.15645 WP_001144202.1.15731 WP_001144202.1.15740 WP_001144202.1.15762 WP_001144202.1.15771 WP_001144202.1.15791 WP_001144202.1.1580 WP_001144202.1.15857 WP_001144202.1.15869 WP_001144202.1.1588 WP_001144202.1.15894 WP_001144202.1.15906 WP_001144202.1.15949 WP_001144202.1.15951 WP_001144202.1.15984 WP_001144202.1.15990 WP_001144202.1.16010 WP_001144202.1.16015 WP_001144202.1.16034 WP_001144202.1.16042 WP_001144202.1.16086 WP_001144202.1.1609 WP_001144202.1.16111 WP_001144202.1.16117 WP_001144202.1.16131 WP_001144202.1.16175 WP_001144202.1.16179 WP_001144202.1.16188 WP_001144202.1.1622 WP_001144202.1.16294 WP_001144202.1.16303 WP_001144202.1.16322 WP_001144202.1.1634 WP_001144202.1.16482 WP_001144202.1.16532 WP_001144202.1.16541 WP_001144202.1.1655 WP_001144202.1.16577 WP_001144202.1.16604 WP_001144202.1.16608 WP_001144202.1.16640 WP_001144202.1.16667 WP_001144202.1.16669 WP_001144202.1.16682 WP_001144202.1.16685 WP_001144202.1.16705 WP_001144202.1.16715 WP_001144202.1.16752 WP_001144202.1.16766 WP_001144202.1.16780 WP_001144202.1.16798 WP_001144202.1.16799 WP_001144202.1.16818 WP_001144202.1.16843 WP_001144202.1.16861 WP_001144202.1.16894 WP_001144202.1.16927 WP_001144202.1.16970 WP_001144202.1.17018 WP_001144202.1.17028 WP_001144202.1.17042 WP_001144202.1.17061 WP_001144202.1.17084 WP_001144202.1.17085 WP_001144202.1.17087 WP_001144202.1.17089 WP_001144202.1.17101 WP_001144202.1.17114 WP_001144202.1.17186 WP_001144202.1.17205 WP_001144202.1.17230 WP_001144202.1.1726 WP_001144202.1.17290 WP_001144202.1.17300 WP_001144202.1.17301 WP_001144202.1.17325 WP_001144202.1.17333 WP_001144202.1.17360 WP_001144202.1.17387 WP_001144202.1.17389 WP_001144202.1.17432 WP_001144202.1.17441 WP_001144202.1.17461 WP_001144202.1.17496 WP_001144202.1.17534 WP_001144202.1.1754 WP_001144202.1.1755 WP_001144202.1.17568 WP_001144202.1.17570 WP_001144202.1.17577 WP_001144202.1.17584 WP_001144202.1.17680 WP_001144202.1.17711 WP_001144202.1.1772 WP_001144202.1.17757 WP_001144202.1.17765 WP_001144202.1.17769 WP_001144202.1.1778 WP_001144202.1.17836 WP_001144202.1.17849 WP_001144202.1.17937 WP_001144202.1.17952 WP_001144202.1.1802 WP_001144202.1.18118 WP_001144202.1.18133 WP_001144202.1.18141 WP_001144202.1.1821 WP_001144202.1.18229 WP_001144202.1.18311 WP_001144202.1.18329 WP_001144202.1.18354 WP_001144202.1.18381 WP_001144202.1.18383 WP_001144202.1.18402 WP_001144202.1.18420 WP_001144202.1.18461 WP_001144202.1.18472 WP_001144202.1.18511 WP_001144202.1.18519 WP_001144202.1.18550 WP_001144202.1.18581 WP_001144202.1.18583 WP_001144202.1.18588 WP_001144202.1.1861 WP_001144202.1.18617 WP_001144202.1.1862 WP_001144202.1.18628 WP_001144202.1.18651 WP_001144202.1.18655 WP_001144202.1.18675 WP_001144202.1.18725 WP_001144202.1.18726 WP_001144202.1.1873 WP_001144202.1.18794 WP_001144202.1.18801 WP_001144202.1.18802 WP_001144202.1.18806 WP_001144202.1.18828 WP_001144202.1.18843 WP_001144202.1.18858 WP_001144202.1.18876 WP_001144202.1.18908 WP_001144202.1.18929 WP_001144202.1.18934 WP_001144202.1.18962 WP_001144202.1.18966 WP_001144202.1.19024 WP_001144202.1.1903 WP_001144202.1.19036 WP_001144202.1.19100 WP_001144202.1.19113 WP_001144202.1.19122 WP_001144202.1.19135 WP_001144202.1.19146 WP_001144202.1.19148 WP_001144202.1.1915 WP_001144202.1.19150 WP_001144202.1.19171 WP_001144202.1.19205 WP_001144202.1.19276 WP_001144202.1.19277 WP_001144202.1.19315 WP_001144202.1.19338 WP_001144202.1.19374 WP_001144202.1.19379 WP_001144202.1.19441 WP_001144202.1.19453 WP_001144202.1.19487 WP_001144202.1.1952 WP_001144202.1.1960 WP_001144202.1.19602 WP_001144202.1.1963 WP_001144202.1.19649 WP_001144202.1.19654 WP_001144202.1.19655 WP_001144202.1.19758 WP_001144202.1.19760 WP_001144202.1.19761 WP_001144202.1.1982 WP_001144202.1.19830 WP_001144202.1.19838 WP_001144202.1.19845 WP_001144202.1.19861 WP_001144202.1.1987 WP_001144202.1.19873 WP_001144202.1.19940 WP_001144202.1.19945 WP_001144202.1.19957 WP_001144202.1.19972 WP_001144202.1.19994 WP_001144202.1.20025 WP_001144202.1.20096 WP_001144202.1.20115 WP_001144202.1.20133 WP_001144202.1.20151 WP_001144202.1.20164 WP_001144202.1.20170 WP_001144202.1.20178 WP_001144202.1.20183 WP_001144202.1.20192 WP_001144202.1.2022 WP_001144202.1.20224 WP_001144202.1.20230 WP_001144202.1.2027 WP_001144202.1.20277 WP_001144202.1.20289 WP_001144202.1.20290 WP_001144202.1.20318 WP_001144202.1.20370 WP_001144202.1.20445 WP_001144202.1.20452 WP_001144202.1.20484 WP_001144202.1.20493 WP_001144202.1.20506 WP_001144202.1.20536 WP_001144202.1.20565 WP_001144202.1.2063 WP_001144202.1.20630 WP_001144202.1.20636 WP_001144202.1.20638 WP_001144202.1.20640 WP_001144202.1.20668 WP_001144202.1.20709 WP_001144202.1.20724 WP_001144202.1.20730 WP_001144202.1.20737 WP_001144202.1.2075 WP_001144202.1.20761 WP_001144202.1.20765 WP_001144202.1.20803 WP_001144202.1.20813 WP_001144202.1.20831 WP_001144202.1.20841 WP_001144202.1.2089 WP_001144202.1.2092 WP_001144202.1.2093 WP_001144202.1.20943 WP_001144202.1.20958 WP_001144202.1.20962 WP_001144202.1.2100 WP_001144202.1.21017 WP_001144202.1.21022 WP_001144202.1.21057 WP_001144202.1.21059 WP_001144202.1.21122 WP_001144202.1.21129 WP_001144202.1.2113 WP_001144202.1.21131 WP_001144202.1.21171 WP_001144202.1.21197 WP_001144202.1.21248 WP_001144202.1.21251 WP_001144202.1.21255 WP_001144202.1.21277 WP_001144202.1.21305 WP_001144202.1.2142 WP_001144202.1.21450 WP_001144202.1.21470 WP_001144202.1.2156 WP_001144202.1.21573 WP_001144202.1.21578 WP_001144202.1.21614 WP_001144202.1.21634 WP_001144202.1.21637 WP_001144202.1.21652 WP_001144202.1.21661 WP_001144202.1.21673 WP_001144202.1.21714 WP_001144202.1.21727 WP_001144202.1.21729 WP_001144202.1.21733 WP_001144202.1.21756 WP_001144202.1.21758 WP_001144202.1.21762 WP_001144202.1.21771 WP_001144202.1.21773 WP_001144202.1.21811 WP_001144202.1.21823 WP_001144202.1.21887 WP_001144202.1.21915 WP_001144202.1.2198 WP_001144202.1.21986 WP_001144202.1.21992 WP_001144202.1.22042 WP_001144202.1.22060 WP_001144202.1.22088 WP_001144202.1.22098 WP_001144202.1.22113 WP_001144202.1.22182 WP_001144202.1.22189 WP_001144202.1.22268 WP_001144202.1.22280 WP_001144202.1.22293 WP_001144202.1.22295 WP_001144202.1.22314 WP_001144202.1.22328 WP_001144202.1.22363 WP_001144202.1.22409 WP_001144202.1.22431 WP_001144202.1.2245 WP_001144202.1.22450 WP_001144202.1.22470 WP_001144202.1.22501 WP_001144202.1.22522 WP_001144202.1.22549 WP_001144202.1.22571 WP_001144202.1.22574 WP_001144202.1.22602 WP_001144202.1.22632 WP_001144202.1.22641 WP_001144202.1.22649 WP_001144202.1.22667 WP_001144202.1.22669 WP_001144202.1.22690 WP_001144202.1.22691 WP_001144202.1.22757 WP_001144202.1.22765 WP_001144202.1.22771 WP_001144202.1.22809 WP_001144202.1.22814 WP_001144202.1.22827 WP_001144202.1.22830 WP_001144202.1.22885 WP_001144202.1.22896 WP_001144202.1.22939 WP_001144202.1.22988 WP_001144202.1.22990 WP_001144202.1.23021 WP_001144202.1.23044 WP_001144202.1.23045 WP_001144202.1.23057 WP_001144202.1.23062 WP_001144202.1.23081 WP_001144202.1.23090 WP_001144202.1.23120 WP_001144202.1.23230 WP_001144202.1.23257 WP_001144202.1.23270 WP_001144202.1.23282 WP_001144202.1.23293 WP_001144202.1.23299 WP_001144202.1.23330 WP_001144202.1.23352 WP_001144202.1.23378 WP_001144202.1.23386 WP_001144202.1.23388 WP_001144202.1.23435 WP_001144202.1.23443 WP_001144202.1.23456 WP_001144202.1.23511 WP_001144202.1.2353 WP_001144202.1.23549 WP_001144202.1.23554 WP_001144202.1.23561 WP_001144202.1.23563 WP_001144202.1.23575 WP_001144202.1.23584 WP_001144202.1.23622 WP_001144202.1.23625 WP_001144202.1.23660 WP_001144202.1.23700 WP_001144202.1.23724 WP_001144202.1.23729 WP_001144202.1.23752 WP_001144202.1.23795 WP_001144202.1.23812 WP_001144202.1.23869 WP_001144202.1.23881 WP_001144202.1.23898 WP_001144202.1.23914 WP_001144202.1.23931 WP_001144202.1.23945 WP_001144202.1.2395 WP_001144202.1.23953 WP_001144202.1.23960 WP_001144202.1.23962 WP_001144202.1.23970 WP_001144202.1.23971 WP_001144202.1.24 WP_001144202.1.24038 WP_001144202.1.24045 WP_001144202.1.24051 WP_001144202.1.24058 WP_001144202.1.24088 WP_001144202.1.24120 WP_001144202.1.2413 WP_001144202.1.24169 WP_001144202.1.24177 WP_001144202.1.2418 WP_001144202.1.24194 WP_001144202.1.24233 WP_001144202.1.2428 WP_001144202.1.24290 WP_001144202.1.24304 WP_001144202.1.24316 WP_001144202.1.2433 WP_001144202.1.24362 WP_001144202.1.2437 WP_001144202.1.24458 WP_001144202.1.24524 WP_001144202.1.24533 WP_001144202.1.24547 WP_001144202.1.2456 WP_001144202.1.24560 WP_001144202.1.24570 WP_001144202.1.24577 WP_001144202.1.24592 WP_001144202.1.24616 WP_001144202.1.24634 WP_001144202.1.24703 WP_001144202.1.24752 WP_001144202.1.24758 WP_001144202.1.24763 WP_001144202.1.24783 WP_001144202.1.24791 WP_001144202.1.24797 WP_001144202.1.24799 WP_001144202.1.24899 WP_001144202.1.24926 WP_001144202.1.24960 WP_001144202.1.24981 WP_001144202.1.24982 WP_001144202.1.25021 WP_001144202.1.25038 WP_001144202.1.25060 WP_001144202.1.25079 WP_001144202.1.25085 WP_001144202.1.2512 WP_001144202.1.25141 WP_001144202.1.25174 WP_001144202.1.25193 WP_001144202.1.25203 WP_001144202.1.25204 WP_001144202.1.25270 WP_001144202.1.25289 WP_001144202.1.2531 WP_001144202.1.25312 WP_001144202.1.25324 WP_001144202.1.25346 WP_001144202.1.2537 WP_001144202.1.254 WP_001144202.1.2540 WP_001144202.1.25403 WP_001144202.1.255 WP_001144202.1.25517 WP_001144202.1.25598 WP_001144202.1.25602 WP_001144202.1.25612 WP_001144202.1.25643 WP_001144202.1.25652 WP_001144202.1.25680 WP_001144202.1.25681 WP_001144202.1.25712 WP_001144202.1.25713 WP_001144202.1.25717 WP_001144202.1.25718 WP_001144202.1.25724 WP_001144202.1.25750 WP_001144202.1.25753 WP_001144202.1.25799 WP_001144202.1.25855 WP_001144202.1.2588 WP_001144202.1.2589 WP_001144202.1.25890 WP_001144202.1.25915 WP_001144202.1.2597 WP_001144202.1.26005 WP_001144202.1.26040 WP_001144202.1.26048 WP_001144202.1.2606 WP_001144202.1.26092 WP_001144202.1.2612 WP_001144202.1.26131 WP_001144202.1.26135 WP_001144202.1.26175 WP_001144202.1.26196 WP_001144202.1.26262 WP_001144202.1.26331 WP_001144202.1.26379 WP_001144202.1.26398 WP_001144202.1.26403 WP_001144202.1.26419 WP_001144202.1.26438 WP_001144202.1.26443 WP_001144202.1.26467 WP_001144202.1.26480 WP_001144202.1.26517 WP_001144202.1.26570 WP_001144202.1.26574 WP_001144202.1.26575 WP_001144202.1.26579 WP_001144202.1.26627 WP_001144202.1.2665 WP_001144202.1.26659 WP_001144202.1.26660 WP_001144202.1.26688 WP_001144202.1.26736 WP_001144202.1.26782 WP_001144202.1.26837 WP_001144202.1.26839 WP_001144202.1.2688 WP_001144202.1.26932 WP_001144202.1.2694 WP_001144202.1.2695 WP_001144202.1.2700 WP_001144202.1.27057 WP_001144202.1.27105 WP_001144202.1.2712 WP_001144202.1.27134 WP_001144202.1.27188 WP_001144202.1.27260 WP_001144202.1.27396 WP_001144202.1.2745 WP_001144202.1.27451 WP_001144202.1.27472 WP_001144202.1.27520 WP_001144202.1.2755 WP_001144202.1.27560 WP_001144202.1.27585 WP_001144202.1.27611 WP_001144202.1.27683 WP_001144202.1.27693 WP_001144202.1.27734 WP_001144202.1.27786 WP_001144202.1.27797 WP_001144202.1.2782 WP_001144202.1.27846 WP_001144202.1.27861 WP_001144202.1.27871 WP_001144202.1.27879 WP_001144202.1.27923 WP_001144202.1.27932 WP_001144202.1.2794 WP_001144202.1.27957 WP_001144202.1.27971 WP_001144202.1.28008 WP_001144202.1.28051 WP_001144202.1.28102 WP_001144202.1.28128 WP_001144202.1.28145 WP_001144202.1.28167 WP_001144202.1.28168 WP_001144202.1.28184 WP_001144202.1.28199 WP_001144202.1.2823 WP_001144202.1.28268 WP_001144202.1.28271 WP_001144202.1.28305 WP_001144202.1.28314 WP_001144202.1.28345 WP_001144202.1.2838 WP_001144202.1.28414 WP_001144202.1.28433 WP_001144202.1.28440 WP_001144202.1.28491 WP_001144202.1.285 WP_001144202.1.28509 WP_001144202.1.28568 WP_001144202.1.28639 WP_001144202.1.2866 WP_001144202.1.28662 WP_001144202.1.28697 WP_001144202.1.28711 WP_001144202.1.28723 WP_001144202.1.28732 WP_001144202.1.28736 WP_001144202.1.28762 WP_001144202.1.28769 WP_001144202.1.28791 WP_001144202.1.28809 WP_001144202.1.28835 WP_001144202.1.28842 WP_001144202.1.28919 WP_001144202.1.28924 WP_001144202.1.28982 WP_001144202.1.290 WP_001144202.1.29026 WP_001144202.1.29049 WP_001144202.1.29079 WP_001144202.1.29100 WP_001144202.1.29128 WP_001144202.1.29146 WP_001144202.1.29164 WP_001144202.1.29197 WP_001144202.1.29221 WP_001144202.1.29252 WP_001144202.1.29258 WP_001144202.1.2926 WP_001144202.1.2931 WP_001144202.1.29341 WP_001144202.1.29377 WP_001144202.1.29394 WP_001144202.1.29443 WP_001144202.1.2945 WP_001144202.1.29486 WP_001144202.1.29497 WP_001144202.1.29503 WP_001144202.1.29513 WP_001144202.1.29523 WP_001144202.1.29556 WP_001144202.1.29603 WP_001144202.1.2963 WP_001144202.1.29643 WP_001144202.1.29647 WP_001144202.1.29662 WP_001144202.1.29689 WP_001144202.1.29699 WP_001144202.1.29724 WP_001144202.1.29740 WP_001144202.1.29746 WP_001144202.1.29815 WP_001144202.1.29819 WP_001144202.1.29820 WP_001144202.1.29821 WP_001144202.1.29855 WP_001144202.1.29884 WP_001144202.1.29933 WP_001144202.1.29988 WP_001144202.1.30016 WP_001144202.1.30141 WP_001144202.1.30221 WP_001144202.1.30231 WP_001144202.1.30232 WP_001144202.1.30247 WP_001144202.1.30269 WP_001144202.1.30298 WP_001144202.1.30347 WP_001144202.1.30397 WP_001144202.1.30400 WP_001144202.1.30401 WP_001144202.1.30447 WP_001144202.1.30472 WP_001144202.1.30479 WP_001144202.1.30497 WP_001144202.1.30524 WP_001144202.1.30536 WP_001144202.1.30546 WP_001144202.1.30550 WP_001144202.1.30570 WP_001144202.1.30580 WP_001144202.1.306 WP_001144202.1.3063 WP_001144202.1.30639 WP_001144202.1.30640 WP_001144202.1.30658 WP_001144202.1.30691 WP_001144202.1.30700 WP_001144202.1.30749 WP_001144202.1.30762 WP_001144202.1.30783 WP_001144202.1.30808 WP_001144202.1.3083 WP_001144202.1.30887 WP_001144202.1.30896 WP_001144202.1.309 WP_001144202.1.30905 WP_001144202.1.30960 WP_001144202.1.30987 WP_001144202.1.31026 WP_001144202.1.31029 WP_001144202.1.31083 WP_001144202.1.31089 WP_001144202.1.31119 WP_001144202.1.31129 WP_001144202.1.31149 WP_001144202.1.31188 WP_001144202.1.31211 WP_001144202.1.31353 WP_001144202.1.31379 WP_001144202.1.31407 WP_001144202.1.31421 WP_001144202.1.31433 WP_001144202.1.31434 WP_001144202.1.31482 WP_001144202.1.31506 WP_001144202.1.31527 WP_001144202.1.31542 WP_001144202.1.31559 WP_001144202.1.31614 WP_001144202.1.31625 WP_001144202.1.31639 WP_001144202.1.31657 WP_001144202.1.31675 WP_001144202.1.31679 WP_001144202.1.31681 WP_001144202.1.31696 WP_001144202.1.31736 WP_001144202.1.3176 WP_001144202.1.31801 WP_001144202.1.31809 WP_001144202.1.31823 WP_001144202.1.31825 WP_001144202.1.31833 WP_001144202.1.31839 WP_001144202.1.31863 WP_001144202.1.31899 WP_001144202.1.31903 WP_001144202.1.31928 WP_001144202.1.31978 WP_001144202.1.3201 WP_001144202.1.32024 WP_001144202.1.3203 WP_001144202.1.32030 WP_001144202.1.32049 WP_001144202.1.32078 WP_001144202.1.32093 WP_001144202.1.32121 WP_001144202.1.32127 WP_001144202.1.32143 WP_001144202.1.32173 WP_001144202.1.32236 WP_001144202.1.32279 WP_001144202.1.32333 WP_001144202.1.32435 WP_001144202.1.32478 WP_001144202.1.32479 WP_001144202.1.32480 WP_001144202.1.32509 WP_001144202.1.32580 WP_001144202.1.32587 WP_001144202.1.32635 WP_001144202.1.32650 WP_001144202.1.32655 WP_001144202.1.32676 WP_001144202.1.327 WP_001144202.1.32715 WP_001144202.1.32718 WP_001144202.1.32720 WP_001144202.1.32741 WP_001144202.1.32748 WP_001144202.1.32772 WP_001144202.1.32903 WP_001144202.1.32938 WP_001144202.1.32984 WP_001144202.1.33004 WP_001144202.1.33018 WP_001144202.1.33026 WP_001144202.1.33053 WP_001144202.1.33101 WP_001144202.1.33171 WP_001144202.1.33217 WP_001144202.1.33222 WP_001144202.1.3323 WP_001144202.1.33237 WP_001144202.1.33244 WP_001144202.1.33325 WP_001144202.1.33352 WP_001144202.1.33362 WP_001144202.1.33369 WP_001144202.1.33385 WP_001144202.1.33408 WP_001144202.1.33413 WP_001144202.1.33424 WP_001144202.1.33428 WP_001144202.1.33476 WP_001144202.1.33502 WP_001144202.1.33525 WP_001144202.1.33526 WP_001144202.1.33545 WP_001144202.1.33561 WP_001144202.1.33563 WP_001144202.1.33584 WP_001144202.1.33648 WP_001144202.1.33729 WP_001144202.1.33736 WP_001144202.1.33746 WP_001144202.1.33799 WP_001144202.1.33879 WP_001144202.1.33888 WP_001144202.1.33896 WP_001144202.1.33948 WP_001144202.1.33952 WP_001144202.1.33973 WP_001144202.1.33979 WP_001144202.1.34003 WP_001144202.1.3401 WP_001144202.1.34124 WP_001144202.1.34144 WP_001144202.1.3415 WP_001144202.1.342 WP_001144202.1.34204 WP_001144202.1.34208 WP_001144202.1.34277 WP_001144202.1.34294 WP_001144202.1.34303 WP_001144202.1.3432 WP_001144202.1.34341 WP_001144202.1.34348 WP_001144202.1.34362 WP_001144202.1.34380 WP_001144202.1.34400 WP_001144202.1.34440 WP_001144202.1.34441 WP_001144202.1.34444 WP_001144202.1.34470 WP_001144202.1.34525 WP_001144202.1.34532 WP_001144202.1.34538 WP_001144202.1.34541 WP_001144202.1.34557 WP_001144202.1.34558 WP_001144202.1.34617 WP_001144202.1.34655 WP_001144202.1.34668 WP_001144202.1.34675 WP_001144202.1.34683 WP_001144202.1.3469 WP_001144202.1.3472 WP_001144202.1.34727 WP_001144202.1.34827 WP_001144202.1.34835 WP_001144202.1.34838 WP_001144202.1.34913 WP_001144202.1.34983 WP_001144202.1.34990 WP_001144202.1.34993 WP_001144202.1.35003 WP_001144202.1.35012 WP_001144202.1.35107 WP_001144202.1.35127 WP_001144202.1.35132 WP_001144202.1.3515 WP_001144202.1.35168 WP_001144202.1.35186 WP_001144202.1.35204 WP_001144202.1.35208 WP_001144202.1.3521 WP_001144202.1.35211 WP_001144202.1.35220 WP_001144202.1.35253 WP_001144202.1.35328 WP_001144202.1.35360 WP_001144202.1.35365 WP_001144202.1.35368 WP_001144202.1.35394 WP_001144202.1.35398 WP_001144202.1.35448 WP_001144202.1.35466 WP_001144202.1.35483 WP_001144202.1.35578 WP_001144202.1.35649 WP_001144202.1.35651 WP_001144202.1.35654 WP_001144202.1.35698 WP_001144202.1.35704 WP_001144202.1.35724 WP_001144202.1.35741 WP_001144202.1.35744 WP_001144202.1.35889 WP_001144202.1.35904 WP_001144202.1.35983 WP_001144202.1.35990 WP_001144202.1.36040 WP_001144202.1.36105 WP_001144202.1.36129 WP_001144202.1.36132 WP_001144202.1.36158 WP_001144202.1.36159 WP_001144202.1.36164 WP_001144202.1.3624 WP_001144202.1.36281 WP_001144202.1.36299 WP_001144202.1.36332 WP_001144202.1.36334 WP_001144202.1.36352 WP_001144202.1.36386 WP_001144202.1.36414 WP_001144202.1.36459 WP_001144202.1.365 WP_001144202.1.36537 WP_001144202.1.36545 WP_001144202.1.36667 WP_001144202.1.3668 WP_001144202.1.36699 WP_001144202.1.3671 WP_001144202.1.36724 WP_001144202.1.36739 WP_001144202.1.36746 WP_001144202.1.36747 WP_001144202.1.36799 WP_001144202.1.36806 WP_001144202.1.36856 WP_001144202.1.36886 WP_001144202.1.36904 WP_001144202.1.36971 WP_001144202.1.37006 WP_001144202.1.37032 WP_001144202.1.37049 WP_001144202.1.37076 WP_001144202.1.37101 WP_001144202.1.37103 WP_001144202.1.37122 WP_001144202.1.37146 WP_001144202.1.37153 WP_001144202.1.37155 WP_001144202.1.37226 WP_001144202.1.3723 WP_001144202.1.37233 WP_001144202.1.37261 WP_001144202.1.37266 WP_001144202.1.37290 WP_001144202.1.3730 WP_001144202.1.37312 WP_001144202.1.37313 WP_001144202.1.37360 WP_001144202.1.37388 WP_001144202.1.37419 WP_001144202.1.37433 WP_001144202.1.37445 WP_001144202.1.37477 WP_001144202.1.37485 WP_001144202.1.3749 WP_001144202.1.37516 WP_001144202.1.37543 WP_001144202.1.37549 WP_001144202.1.37576 WP_001144202.1.37588 WP_001144202.1.37592 WP_001144202.1.37637 WP_001144202.1.37664 WP_001144202.1.37730 WP_001144202.1.37736 WP_001144202.1.37745 WP_001144202.1.37817 WP_001144202.1.37830 WP_001144202.1.37847 WP_001144202.1.37897 WP_001144202.1.37923 WP_001144202.1.37940 WP_001144202.1.3796 WP_001144202.1.37962 WP_001144202.1.37964 WP_001144202.1.38043 WP_001144202.1.38105 WP_001144202.1.3811 WP_001144202.1.38119 WP_001144202.1.3815 WP_001144202.1.38155 WP_001144202.1.38182 WP_001144202.1.38185 WP_001144202.1.38194 WP_001144202.1.38202 WP_001144202.1.38234 WP_001144202.1.38264 WP_001144202.1.38323 WP_001144202.1.38392 WP_001144202.1.38419 WP_001144202.1.38567 WP_001144202.1.38636 WP_001144202.1.38782 WP_001144202.1.38827 WP_001144202.1.38937 WP_001144202.1.38950 WP_001144202.1.38956 WP_001144202.1.39015 WP_001144202.1.3903 WP_001144202.1.39063 WP_001144202.1.39111 WP_001144202.1.3912 WP_001144202.1.39148 WP_001144202.1.39155 WP_001144202.1.39157 WP_001144202.1.39164 WP_001144202.1.39167 WP_001144202.1.39184 WP_001144202.1.39196 WP_001144202.1.39209 WP_001144202.1.3921 WP_001144202.1.3922 WP_001144202.1.39254 WP_001144202.1.39286 WP_001144202.1.39313 WP_001144202.1.39327 WP_001144202.1.39335 WP_001144202.1.39356 WP_001144202.1.39358 WP_001144202.1.39365 WP_001144202.1.39373 WP_001144202.1.39377 WP_001144202.1.39402 WP_001144202.1.39423 WP_001144202.1.39430 WP_001144202.1.39468 WP_001144202.1.39492 WP_001144202.1.39575 WP_001144202.1.39580 WP_001144202.1.39626 WP_001144202.1.39651 WP_001144202.1.39709 WP_001144202.1.39715 WP_001144202.1.39717 WP_001144202.1.39726 WP_001144202.1.39730 WP_001144202.1.39733 WP_001144202.1.39734 WP_001144202.1.39796 WP_001144202.1.3980 WP_001144202.1.39829 WP_001144202.1.39870 WP_001144202.1.39892 WP_001144202.1.39938 WP_001144202.1.39961 WP_001144202.1.39966 WP_001144202.1.39973 WP_001144202.1.39998 WP_001144202.1.40 WP_001144202.1.40016 WP_001144202.1.40019 WP_001144202.1.4005 WP_001144202.1.40088 WP_001144202.1.40121 WP_001144202.1.40140 WP_001144202.1.40159 WP_001144202.1.40183 WP_001144202.1.40192 WP_001144202.1.40211 WP_001144202.1.40218 WP_001144202.1.40298 WP_001144202.1.40317 WP_001144202.1.40349 WP_001144202.1.40389 WP_001144202.1.40445 WP_001144202.1.40486 WP_001144202.1.40499 WP_001144202.1.40524 WP_001144202.1.40548 WP_001144202.1.406 WP_001144202.1.40623 WP_001144202.1.40666 WP_001144202.1.40668 WP_001144202.1.40712 WP_001144202.1.4081 WP_001144202.1.40815 WP_001144202.1.40833 WP_001144202.1.40842 WP_001144202.1.40843 WP_001144202.1.40893 WP_001144202.1.40912 WP_001144202.1.40937 WP_001144202.1.40965 WP_001144202.1.41041 WP_001144202.1.41078 WP_001144202.1.41113 WP_001144202.1.41206 WP_001144202.1.4122 WP_001144202.1.41230 WP_001144202.1.41259 WP_001144202.1.4126 WP_001144202.1.41332 WP_001144202.1.41339 WP_001144202.1.41372 WP_001144202.1.41391 WP_001144202.1.41394 WP_001144202.1.41401 WP_001144202.1.41436 WP_001144202.1.41449 WP_001144202.1.41457 WP_001144202.1.41479 WP_001144202.1.41481 WP_001144202.1.41483 WP_001144202.1.41513 WP_001144202.1.41539 WP_001144202.1.41556 WP_001144202.1.4158 WP_001144202.1.41606 WP_001144202.1.41718 WP_001144202.1.41778 WP_001144202.1.41782 WP_001144202.1.41809 WP_001144202.1.41822 WP_001144202.1.41837 WP_001144202.1.41847 WP_001144202.1.41884 WP_001144202.1.4189 WP_001144202.1.41900 WP_001144202.1.41923 WP_001144202.1.4193 WP_001144202.1.41960 WP_001144202.1.41964 WP_001144202.1.41991 WP_001144202.1.42022 WP_001144202.1.42033 WP_001144202.1.42044 WP_001144202.1.42095 WP_001144202.1.42096 WP_001144202.1.42113 WP_001144202.1.42151 WP_001144202.1.42159 WP_001144202.1.42191 WP_001144202.1.42209 WP_001144202.1.42214 WP_001144202.1.42221 WP_001144202.1.42228 WP_001144202.1.42233 WP_001144202.1.42277 WP_001144202.1.42300 WP_001144202.1.42318 WP_001144202.1.42350 WP_001144202.1.42359 WP_001144202.1.42369 WP_001144202.1.42376 WP_001144202.1.42413 WP_001144202.1.4242 WP_001144202.1.42443 WP_001144202.1.42448 WP_001144202.1.42456 WP_001144202.1.42586 WP_001144202.1.42600 WP_001144202.1.42670 WP_001144202.1.42709 WP_001144202.1.42728 WP_001144202.1.42750 WP_001144202.1.42770 WP_001144202.1.42791 WP_001144202.1.42804 WP_001144202.1.42808 WP_001144202.1.4282 WP_001144202.1.42828 WP_001144202.1.42830 WP_001144202.1.42879 WP_001144202.1.42903 WP_001144202.1.42936 WP_001144202.1.42950 WP_001144202.1.42966 WP_001144202.1.42987 WP_001144202.1.42991 WP_001144202.1.43027 WP_001144202.1.4306 WP_001144202.1.43123 WP_001144202.1.43133 WP_001144202.1.43213 WP_001144202.1.43216 WP_001144202.1.43270 WP_001144202.1.43324 WP_001144202.1.4334 WP_001144202.1.43374 WP_001144202.1.43422 WP_001144202.1.43427 WP_001144202.1.43473 WP_001144202.1.43489 WP_001144202.1.43501 WP_001144202.1.4356 WP_001144202.1.43561 WP_001144202.1.43566 WP_001144202.1.43598 WP_001144202.1.436 WP_001144202.1.43720 WP_001144202.1.43733 WP_001144202.1.43738 WP_001144202.1.43803 WP_001144202.1.43868 WP_001144202.1.43918 WP_001144202.1.43925 WP_001144202.1.43953 WP_001144202.1.43966 WP_001144202.1.440 WP_001144202.1.4400 WP_001144202.1.44051 WP_001144202.1.44088 WP_001144202.1.44100 WP_001144202.1.4411 WP_001144202.1.44115 WP_001144202.1.44162 WP_001144202.1.44166 WP_001144202.1.44222 WP_001144202.1.44264 WP_001144202.1.44287 WP_001144202.1.44314 WP_001144202.1.44327 WP_001144202.1.44365 WP_001144202.1.44394 WP_001144202.1.44422 WP_001144202.1.44424 WP_001144202.1.44426 WP_001144202.1.4445 WP_001144202.1.44458 WP_001144202.1.44539 WP_001144202.1.4454 WP_001144202.1.44558 WP_001144202.1.4459 WP_001144202.1.44610 WP_001144202.1.44622 WP_001144202.1.44627 WP_001144202.1.4463 WP_001144202.1.44642 WP_001144202.1.44649 WP_001144202.1.44668 WP_001144202.1.44671 WP_001144202.1.44686 WP_001144202.1.4471 WP_001144202.1.44717 WP_001144202.1.44724 WP_001144202.1.44759 WP_001144202.1.44784 WP_001144202.1.448 WP_001144202.1.44800 WP_001144202.1.44814 WP_001144202.1.44818 WP_001144202.1.44836 WP_001144202.1.44841 WP_001144202.1.44843 WP_001144202.1.44848 WP_001144202.1.44849 WP_001144202.1.44855 WP_001144202.1.44923 WP_001144202.1.44960 WP_001144202.1.44970 WP_001144202.1.44975 WP_001144202.1.44977 WP_001144202.1.44980 WP_001144202.1.45068 WP_001144202.1.45156 WP_001144202.1.4516 WP_001144202.1.45190 WP_001144202.1.45208 WP_001144202.1.4524 WP_001144202.1.45246 WP_001144202.1.4530 WP_001144202.1.4535 WP_001144202.1.4538 WP_001144202.1.45392 WP_001144202.1.4541 WP_001144202.1.45444 WP_001144202.1.45486 WP_001144202.1.45494 WP_001144202.1.45500 WP_001144202.1.45525 WP_001144202.1.45536 WP_001144202.1.45565 WP_001144202.1.45581 WP_001144202.1.45595 WP_001144202.1.4563 WP_001144202.1.45664 WP_001144202.1.45674 WP_001144202.1.4570 WP_001144202.1.45740 WP_001144202.1.45741 WP_001144202.1.4576 WP_001144202.1.45789 WP_001144202.1.45793 WP_001144202.1.45799 WP_001144202.1.45801 WP_001144202.1.45806 WP_001144202.1.45891 WP_001144202.1.45921 WP_001144202.1.4593 WP_001144202.1.45931 WP_001144202.1.45933 WP_001144202.1.45949 WP_001144202.1.45962 WP_001144202.1.45990 WP_001144202.1.45991 WP_001144202.1.4600 WP_001144202.1.46016 WP_001144202.1.46026 WP_001144202.1.46115 WP_001144202.1.46122 WP_001144202.1.4617 WP_001144202.1.46186 WP_001144202.1.46213 WP_001144202.1.46217 WP_001144202.1.46245 WP_001144202.1.46263 WP_001144202.1.46325 WP_001144202.1.46378 WP_001144202.1.46429 WP_001144202.1.4643 WP_001144202.1.46438 WP_001144202.1.46441 WP_001144202.1.46468 WP_001144202.1.46487 WP_001144202.1.46531 WP_001144202.1.46541 WP_001144202.1.46573 WP_001144202.1.46582 WP_001144202.1.46594 WP_001144202.1.46643 WP_001144202.1.46655 WP_001144202.1.46734 WP_001144202.1.46795 WP_001144202.1.46798 WP_001144202.1.46802 WP_001144202.1.46820 WP_001144202.1.46833 WP_001144202.1.46841 WP_001144202.1.46857 WP_001144202.1.46909 WP_001144202.1.46932 WP_001144202.1.4695 WP_001144202.1.46991 WP_001144202.1.46994 WP_001144202.1.47024 WP_001144202.1.47030 WP_001144202.1.47038 WP_001144202.1.47039 WP_001144202.1.47047 WP_001144202.1.47048 WP_001144202.1.47054 WP_001144202.1.47063 WP_001144202.1.47073 WP_001144202.1.47124 WP_001144202.1.47135 WP_001144202.1.47167 WP_001144202.1.47171 WP_001144202.1.47189 WP_001144202.1.47224 WP_001144202.1.47235 WP_001144202.1.47247 WP_001144202.1.47316 WP_001144202.1.47344 WP_001144202.1.47350 WP_001144202.1.47366 WP_001144202.1.47386 WP_001144202.1.47414 WP_001144202.1.47416 WP_001144202.1.4743 WP_001144202.1.47451 WP_001144202.1.47454 WP_001144202.1.47496 WP_001144202.1.47498 WP_001144202.1.47533 WP_001144202.1.47546 WP_001144202.1.47582 WP_001144202.1.47599 WP_001144202.1.47634 WP_001144202.1.47646 WP_001144202.1.47654 WP_001144202.1.47709 WP_001144202.1.4772 WP_001144202.1.47722 WP_001144202.1.4773 WP_001144202.1.47734 WP_001144202.1.47764 WP_001144202.1.47765 WP_001144202.1.47775 WP_001144202.1.47791 WP_001144202.1.47914 WP_001144202.1.47981 WP_001144202.1.47983 WP_001144202.1.48029 WP_001144202.1.48040 WP_001144202.1.48087 WP_001144202.1.48090 WP_001144202.1.48096 WP_001144202.1.4811 WP_001144202.1.48111 WP_001144202.1.48121 WP_001144202.1.48168 WP_001144202.1.48194 WP_001144202.1.48200 WP_001144202.1.48216 WP_001144202.1.48229 WP_001144202.1.48265 WP_001144202.1.48285 WP_001144202.1.48353 WP_001144202.1.48404 WP_001144202.1.48417 WP_001144202.1.48431 WP_001144202.1.48590 WP_001144202.1.486 WP_001144202.1.48602 WP_001144202.1.48620 WP_001144202.1.48626 WP_001144202.1.48629 WP_001144202.1.48678 WP_001144202.1.48689 WP_001144202.1.4871 WP_001144202.1.4876 WP_001144202.1.48808 WP_001144202.1.48825 WP_001144202.1.48847 WP_001144202.1.48907 WP_001144202.1.48910 WP_001144202.1.48926 WP_001144202.1.48953 WP_001144202.1.48974 WP_001144202.1.49009 WP_001144202.1.49061 WP_001144202.1.49136 WP_001144202.1.49170 WP_001144202.1.49179 WP_001144202.1.49258 WP_001144202.1.49259 WP_001144202.1.49321 WP_001144202.1.49338 WP_001144202.1.49363 WP_001144202.1.49431 WP_001144202.1.49446 WP_001144202.1.49483 WP_001144202.1.49522 WP_001144202.1.49528 WP_001144202.1.4953 WP_001144202.1.49531 WP_001144202.1.49537 WP_001144202.1.49621 WP_001144202.1.49645 WP_001144202.1.49661 WP_001144202.1.49662 WP_001144202.1.49675 WP_001144202.1.49684 WP_001144202.1.49733 WP_001144202.1.49740 WP_001144202.1.49768 WP_001144202.1.49777 WP_001144202.1.49788 WP_001144202.1.49794 WP_001144202.1.49820 WP_001144202.1.49823 WP_001144202.1.4985 WP_001144202.1.49900 WP_001144202.1.49902 WP_001144202.1.49941 WP_001144202.1.50006 WP_001144202.1.50008 WP_001144202.1.50056 WP_001144202.1.50078 WP_001144202.1.50098 WP_001144202.1.50136 WP_001144202.1.50146 WP_001144202.1.5017 WP_001144202.1.50187 WP_001144202.1.50191 WP_001144202.1.50196 WP_001144202.1.50214 WP_001144202.1.50228 WP_001144202.1.50230 WP_001144202.1.50262 WP_001144202.1.50273 WP_001144202.1.50278 WP_001144202.1.50381 WP_001144202.1.5040 WP_001144202.1.5041 WP_001144202.1.50452 WP_001144202.1.5046 WP_001144202.1.50539 WP_001144202.1.50548 WP_001144202.1.50579 WP_001144202.1.506 WP_001144202.1.50608 WP_001144202.1.5061 WP_001144202.1.50627 WP_001144202.1.50728 WP_001144202.1.50925 WP_001144202.1.50936 WP_001144202.1.50947 WP_001144202.1.5095 WP_001144202.1.50957 WP_001144202.1.50993 WP_001144202.1.51042 WP_001144202.1.511 WP_001144202.1.51127 WP_001144202.1.51172 WP_001144202.1.51201 WP_001144202.1.51206 WP_001144202.1.51300 WP_001144202.1.51320 WP_001144202.1.51336 WP_001144202.1.51354 WP_001144202.1.51360 WP_001144202.1.51364 WP_001144202.1.51380 WP_001144202.1.51426 WP_001144202.1.5146 WP_001144202.1.51482 WP_001144202.1.51495 WP_001144202.1.51503 WP_001144202.1.51513 WP_001144202.1.5153 WP_001144202.1.51539 WP_001144202.1.51542 WP_001144202.1.51548 WP_001144202.1.51552 WP_001144202.1.5158 WP_001144202.1.51600 WP_001144202.1.51607 WP_001144202.1.51624 WP_001144202.1.51662 WP_001144202.1.51690 WP_001144202.1.51736 WP_001144202.1.51757 WP_001144202.1.51760 WP_001144202.1.518 WP_001144202.1.51804 WP_001144202.1.51869 WP_001144202.1.51873 WP_001144202.1.51881 WP_001144202.1.51896 WP_001144202.1.51906 WP_001144202.1.51944 WP_001144202.1.51949 WP_001144202.1.51968 WP_001144202.1.51979 WP_001144202.1.5199 WP_001144202.1.52011 WP_001144202.1.52020 WP_001144202.1.52044 WP_001144202.1.52076 WP_001144202.1.52085 WP_001144202.1.52111 WP_001144202.1.52126 WP_001144202.1.52127 WP_001144202.1.52137 WP_001144202.1.52186 WP_001144202.1.52211 WP_001144202.1.52213 WP_001144202.1.52225 WP_001144202.1.52230 WP_001144202.1.52236 WP_001144202.1.52240 WP_001144202.1.52243 WP_001144202.1.52257 WP_001144202.1.52258 WP_001144202.1.52271 WP_001144202.1.52299 WP_001144202.1.52304 WP_001144202.1.52305 WP_001144202.1.52313 WP_001144202.1.52324 WP_001144202.1.52328 WP_001144202.1.52333 WP_001144202.1.52363 WP_001144202.1.52406 WP_001144202.1.52413 WP_001144202.1.52421 WP_001144202.1.52492 WP_001144202.1.52544 WP_001144202.1.52554 WP_001144202.1.52558 WP_001144202.1.52567 WP_001144202.1.52568 WP_001144202.1.52601 WP_001144202.1.52755 WP_001144202.1.52771 WP_001144202.1.52774 WP_001144202.1.52781 WP_001144202.1.52844 WP_001144202.1.5285 WP_001144202.1.52852 WP_001144202.1.52853 WP_001144202.1.52855 WP_001144202.1.52895 WP_001144202.1.5291 WP_001144202.1.52942 WP_001144202.1.52996 WP_001144202.1.53012 WP_001144202.1.53020 WP_001144202.1.53021 WP_001144202.1.53065 WP_001144202.1.53095 WP_001144202.1.53099 WP_001144202.1.53110 WP_001144202.1.53123 WP_001144202.1.53186 WP_001144202.1.5322 WP_001144202.1.53277 WP_001144202.1.53308 WP_001144202.1.53360 WP_001144202.1.53377 WP_001144202.1.53410 WP_001144202.1.53419 WP_001144202.1.53428 WP_001144202.1.53431 WP_001144202.1.5351 WP_001144202.1.53535 WP_001144202.1.53545 WP_001144202.1.53556 WP_001144202.1.53557 WP_001144202.1.53574 WP_001144202.1.53582 WP_001144202.1.53587 WP_001144202.1.53589 WP_001144202.1.53590 WP_001144202.1.53649 WP_001144202.1.53690 WP_001144202.1.53693 WP_001144202.1.53769 WP_001144202.1.53810 WP_001144202.1.53811 WP_001144202.1.53841 WP_001144202.1.53878 WP_001144202.1.53884 WP_001144202.1.5393 WP_001144202.1.53931 WP_001144202.1.5395 WP_001144202.1.53968 WP_001144202.1.53972 WP_001144202.1.53994 WP_001144202.1.54002 WP_001144202.1.54028 WP_001144202.1.54032 WP_001144202.1.54051 WP_001144202.1.54102 WP_001144202.1.54188 WP_001144202.1.54208 WP_001144202.1.54263 WP_001144202.1.54313 WP_001144202.1.5433 WP_001144202.1.5434 WP_001144202.1.54344 WP_001144202.1.54388 WP_001144202.1.54394 WP_001144202.1.5440 WP_001144202.1.54411 WP_001144202.1.54417 WP_001144202.1.54476 WP_001144202.1.54507 WP_001144202.1.54524 WP_001144202.1.54534 WP_001144202.1.54590 WP_001144202.1.54601 WP_001144202.1.54602 WP_001144202.1.54614 WP_001144202.1.54617 WP_001144202.1.54620 WP_001144202.1.54641 WP_001144202.1.5470 WP_001144202.1.54754 WP_001144202.1.54755 WP_001144202.1.54760 WP_001144202.1.5478 WP_001144202.1.54875 WP_001144202.1.54921 WP_001144202.1.54940 WP_001144202.1.54946 WP_001144202.1.54972 WP_001144202.1.54981 WP_001144202.1.54989 WP_001144202.1.54993 WP_001144202.1.55003 WP_001144202.1.55070 WP_001144202.1.55123 WP_001144202.1.55151 WP_001144202.1.55177 WP_001144202.1.55179 WP_001144202.1.55203 WP_001144202.1.55226 WP_001144202.1.55273 WP_001144202.1.55275 WP_001144202.1.55291 WP_001144202.1.55359 WP_001144202.1.55420 WP_001144202.1.5546 WP_001144202.1.55466 WP_001144202.1.55472 WP_001144202.1.55482 WP_001144202.1.55483 WP_001144202.1.55507 WP_001144202.1.55529 WP_001144202.1.55550 WP_001144202.1.55551 WP_001144202.1.55563 WP_001144202.1.55571 WP_001144202.1.55574 WP_001144202.1.55581 WP_001144202.1.55629 WP_001144202.1.5566 WP_001144202.1.55676 WP_001144202.1.55727 WP_001144202.1.55731 WP_001144202.1.55790 WP_001144202.1.55808 WP_001144202.1.55825 WP_001144202.1.55868 WP_001144202.1.55888 WP_001144202.1.55896 WP_001144202.1.55979 WP_001144202.1.55990 WP_001144202.1.561 WP_001144202.1.56101 WP_001144202.1.56122 WP_001144202.1.5614 WP_001144202.1.56164 WP_001144202.1.56169 WP_001144202.1.56197 WP_001144202.1.562 WP_001144202.1.56285 WP_001144202.1.56293 WP_001144202.1.56345 WP_001144202.1.56358 WP_001144202.1.56388 WP_001144202.1.56446 WP_001144202.1.56469 WP_001144202.1.5649 WP_001144202.1.56502 WP_001144202.1.56523 WP_001144202.1.56573 WP_001144202.1.56650 WP_001144202.1.56662 WP_001144202.1.56713 WP_001144202.1.56776 WP_001144202.1.56777 WP_001144202.1.56787 WP_001144202.1.56789 WP_001144202.1.56846 WP_001144202.1.56908 WP_001144202.1.56934 WP_001144202.1.56937 WP_001144202.1.56941 WP_001144202.1.56951 WP_001144202.1.56992 WP_001144202.1.57045 WP_001144202.1.57079 WP_001144202.1.57150 WP_001144202.1.57159 WP_001144202.1.57181 WP_001144202.1.57182 WP_001144202.1.57185 WP_001144202.1.57254 WP_001144202.1.57266 WP_001144202.1.57269 WP_001144202.1.57319 WP_001144202.1.57348 WP_001144202.1.57395 WP_001144202.1.57401 WP_001144202.1.57403 WP_001144202.1.57410 WP_001144202.1.57414 WP_001144202.1.5742 WP_001144202.1.57432 WP_001144202.1.57438 WP_001144202.1.57492 WP_001144202.1.57539 WP_001144202.1.57550 WP_001144202.1.57574 WP_001144202.1.57588 WP_001144202.1.57608 WP_001144202.1.57628 WP_001144202.1.57634 WP_001144202.1.57663 WP_001144202.1.57669 WP_001144202.1.57719 WP_001144202.1.57832 WP_001144202.1.57846 WP_001144202.1.57854 WP_001144202.1.5787 WP_001144202.1.57898 WP_001144202.1.57903 WP_001144202.1.57951 WP_001144202.1.57975 WP_001144202.1.57983 WP_001144202.1.57994 WP_001144202.1.58009 WP_001144202.1.58038 WP_001144202.1.58080 WP_001144202.1.58092 WP_001144202.1.58097 WP_001144202.1.58098 WP_001144202.1.5810 WP_001144202.1.58107 WP_001144202.1.58136 WP_001144202.1.58232 WP_001144202.1.58233 WP_001144202.1.58292 WP_001144202.1.58336 WP_001144202.1.58345 WP_001144202.1.58368 WP_001144202.1.58401 WP_001144202.1.58408 WP_001144202.1.58414 WP_001144202.1.5842 WP_001144202.1.58420 WP_001144202.1.58424 WP_001144202.1.58429 WP_001144202.1.58440 WP_001144202.1.58459 WP_001144202.1.58484 WP_001144202.1.585 WP_001144202.1.58560 WP_001144202.1.58572 WP_001144202.1.58617 WP_001144202.1.58657 WP_001144202.1.58680 WP_001144202.1.58692 WP_001144202.1.58737 WP_001144202.1.58799 WP_001144202.1.58867 WP_001144202.1.58901 WP_001144202.1.58940 WP_001144202.1.58942 WP_001144202.1.58951 WP_001144202.1.58958 WP_001144202.1.58976 WP_001144202.1.58999 WP_001144202.1.59024 WP_001144202.1.59035 WP_001144202.1.59060 WP_001144202.1.59165 WP_001144202.1.59218 WP_001144202.1.59226 WP_001144202.1.59263 WP_001144202.1.5927 WP_001144202.1.59291 WP_001144202.1.59292 WP_001144202.1.59306 WP_001144202.1.59396 WP_001144202.1.59407 WP_001144202.1.59425 WP_001144202.1.59483 WP_001144202.1.59513 WP_001144202.1.59553 WP_001144202.1.59577 WP_001144202.1.59579 WP_001144202.1.59611 WP_001144202.1.59613 WP_001144202.1.5965 WP_001144202.1.59689 WP_001144202.1.597 WP_001144202.1.59714 WP_001144202.1.59748 WP_001144202.1.59788 WP_001144202.1.59791 WP_001144202.1.59793 WP_001144202.1.59815 WP_001144202.1.59853 WP_001144202.1.59855 WP_001144202.1.59894 WP_001144202.1.5990 WP_001144202.1.59900 WP_001144202.1.59912 WP_001144202.1.59914 WP_001144202.1.59970 WP_001144202.1.59980 WP_001144202.1.59981 WP_001144202.1.59998 WP_001144202.1.60005 WP_001144202.1.6002 WP_001144202.1.60023 WP_001144202.1.60031 WP_001144202.1.60096 WP_001144202.1.60110 WP_001144202.1.60186 WP_001144202.1.60225 WP_001144202.1.60246 WP_001144202.1.60337 WP_001144202.1.60342 WP_001144202.1.60343 WP_001144202.1.60350 WP_001144202.1.60411 WP_001144202.1.60443 WP_001144202.1.60498 WP_001144202.1.60544 WP_001144202.1.60550 WP_001144202.1.60555 WP_001144202.1.60559 WP_001144202.1.60567 WP_001144202.1.60570 WP_001144202.1.60576 WP_001144202.1.60591 WP_001144202.1.60599 WP_001144202.1.6061 WP_001144202.1.60614 WP_001144202.1.60630 WP_001144202.1.60644 WP_001144202.1.60654 WP_001144202.1.6066 WP_001144202.1.60671 WP_001144202.1.6068 WP_001144202.1.60684 WP_001144202.1.60717 WP_001144202.1.60764 WP_001144202.1.60771 WP_001144202.1.60816 WP_001144202.1.60826 WP_001144202.1.60847 WP_001144202.1.60895 WP_001144202.1.60901 WP_001144202.1.60921 WP_001144202.1.60925 WP_001144202.1.6094 WP_001144202.1.60974 WP_001144202.1.61006 WP_001144202.1.61008 WP_001144202.1.61035 WP_001144202.1.61096 WP_001144202.1.61132 WP_001144202.1.61148 WP_001144202.1.61170 WP_001144202.1.61175 WP_001144202.1.61223 WP_001144202.1.61241 WP_001144202.1.61268 WP_001144202.1.613 WP_001144202.1.61360 WP_001144202.1.61362 WP_001144202.1.61364 WP_001144202.1.61373 WP_001144202.1.6138 WP_001144202.1.61442 WP_001144202.1.61480 WP_001144202.1.61496 WP_001144202.1.615 WP_001144202.1.61517 WP_001144202.1.61524 WP_001144202.1.61612 WP_001144202.1.61643 WP_001144202.1.61663 WP_001144202.1.61703 WP_001144202.1.61718 WP_001144202.1.61739 WP_001144202.1.61770 WP_001144202.1.61779 WP_001144202.1.61822 WP_001144202.1.61835 WP_001144202.1.61853 WP_001144202.1.61858 WP_001144202.1.61893 WP_001144202.1.61949 WP_001144202.1.61955 WP_001144202.1.61966 WP_001144202.1.61985 WP_001144202.1.62038 WP_001144202.1.62043 WP_001144202.1.62091 WP_001144202.1.62099 WP_001144202.1.62157 WP_001144202.1.62236 WP_001144202.1.62262 WP_001144202.1.62303 WP_001144202.1.62322 WP_001144202.1.62348 WP_001144202.1.62424 WP_001144202.1.6245 WP_001144202.1.62507 WP_001144202.1.62513 WP_001144202.1.62541 WP_001144202.1.62586 WP_001144202.1.62612 WP_001144202.1.62631 WP_001144202.1.62642 WP_001144202.1.62646 WP_001144202.1.62668 WP_001144202.1.62735 WP_001144202.1.62750 WP_001144202.1.62780 WP_001144202.1.62802 WP_001144202.1.62812 WP_001144202.1.62819 WP_001144202.1.6282 WP_001144202.1.62840 WP_001144202.1.62866 WP_001144202.1.62885 WP_001144202.1.62914 WP_001144202.1.62919 WP_001144202.1.62951 WP_001144202.1.62989 WP_001144202.1.62992 WP_001144202.1.63023 WP_001144202.1.6307 WP_001144202.1.63113 WP_001144202.1.63167 WP_001144202.1.63271 WP_001144202.1.63305 WP_001144202.1.63310 WP_001144202.1.63330 WP_001144202.1.6334 WP_001144202.1.63350 WP_001144202.1.6337 WP_001144202.1.63419 WP_001144202.1.63433 WP_001144202.1.63435 WP_001144202.1.63453 WP_001144202.1.63465 WP_001144202.1.6348 WP_001144202.1.63487 WP_001144202.1.63554 WP_001144202.1.63602 WP_001144202.1.63608 WP_001144202.1.63612 WP_001144202.1.63679 WP_001144202.1.63683 WP_001144202.1.63800 WP_001144202.1.63814 WP_001144202.1.63856 WP_001144202.1.63871 WP_001144202.1.63944 WP_001144202.1.63969 WP_001144202.1.63990 WP_001144202.1.64030 WP_001144202.1.64040 WP_001144202.1.64080 WP_001144202.1.64110 WP_001144202.1.64138 WP_001144202.1.64153 WP_001144202.1.64180 WP_001144202.1.64190 WP_001144202.1.64280 WP_001144202.1.64285 WP_001144202.1.643 WP_001144202.1.64312 WP_001144202.1.64330 WP_001144202.1.64355 WP_001144202.1.64437 WP_001144202.1.6444 WP_001144202.1.64448 WP_001144202.1.6446 WP_001144202.1.64520 WP_001144202.1.64540 WP_001144202.1.64563 WP_001144202.1.64634 WP_001144202.1.6469 WP_001144202.1.64695 WP_001144202.1.64712 WP_001144202.1.64784 WP_001144202.1.64789 WP_001144202.1.64793 WP_001144202.1.64821 WP_001144202.1.64875 WP_001144202.1.64895 WP_001144202.1.64901 WP_001144202.1.64912 WP_001144202.1.64926 WP_001144202.1.64939 WP_001144202.1.64990 WP_001144202.1.6500 WP_001144202.1.65097 WP_001144202.1.65104 WP_001144202.1.65110 WP_001144202.1.65135 WP_001144202.1.6516 WP_001144202.1.65192 WP_001144202.1.65240 WP_001144202.1.65256 WP_001144202.1.6527 WP_001144202.1.65271 WP_001144202.1.65296 WP_001144202.1.65353 WP_001144202.1.65355 WP_001144202.1.65364 WP_001144202.1.65366 WP_001144202.1.65405 WP_001144202.1.65484 WP_001144202.1.6553 WP_001144202.1.65565 WP_001144202.1.65571 WP_001144202.1.6563 WP_001144202.1.65662 WP_001144202.1.65667 WP_001144202.1.65677 WP_001144202.1.65714 WP_001144202.1.65749 WP_001144202.1.6576 WP_001144202.1.65834 WP_001144202.1.65954 WP_001144202.1.65957 WP_001144202.1.65961 WP_001144202.1.65976 WP_001144202.1.65991 WP_001144202.1.66016 WP_001144202.1.66050 WP_001144202.1.66059 WP_001144202.1.66071 WP_001144202.1.66104 WP_001144202.1.66105 WP_001144202.1.66161 WP_001144202.1.66187 WP_001144202.1.6622 WP_001144202.1.66255 WP_001144202.1.66264 WP_001144202.1.66280 WP_001144202.1.66327 WP_001144202.1.66335 WP_001144202.1.6635 WP_001144202.1.66387 WP_001144202.1.66389 WP_001144202.1.66392 WP_001144202.1.66432 WP_001144202.1.66448 WP_001144202.1.66501 WP_001144202.1.66511 WP_001144202.1.66523 WP_001144202.1.6654 WP_001144202.1.66559 WP_001144202.1.66644 WP_001144202.1.6665 WP_001144202.1.6666 WP_001144202.1.66667 WP_001144202.1.66668 WP_001144202.1.66700 WP_001144202.1.66706 WP_001144202.1.66708 WP_001144202.1.66719 WP_001144202.1.66727 WP_001144202.1.66751 WP_001144202.1.66787 WP_001144202.1.66791 WP_001144202.1.66794 WP_001144202.1.66933 WP_001144202.1.66975 WP_001144202.1.66978 WP_001144202.1.66984 WP_001144202.1.6701 WP_001144202.1.67022 WP_001144202.1.67029 WP_001144202.1.67035 WP_001144202.1.67047 WP_001144202.1.67055 WP_001144202.1.6706 WP_001144202.1.67116 WP_001144202.1.67132 WP_001144202.1.67149 WP_001144202.1.67158 WP_001144202.1.67164 WP_001144202.1.67193 WP_001144202.1.67200 WP_001144202.1.67210 WP_001144202.1.67272 WP_001144202.1.67284 WP_001144202.1.67373 WP_001144202.1.67412 WP_001144202.1.67415 WP_001144202.1.67456 WP_001144202.1.67462 WP_001144202.1.67467 WP_001144202.1.67468 WP_001144202.1.67495 WP_001144202.1.67538 WP_001144202.1.67553 WP_001144202.1.67590 WP_001144202.1.67669 WP_001144202.1.67704 WP_001144202.1.67758 WP_001144202.1.67786 WP_001144202.1.67787 WP_001144202.1.67802 WP_001144202.1.67853 WP_001144202.1.67891 WP_001144202.1.67894 WP_001144202.1.67901 WP_001144202.1.6793 WP_001144202.1.67938 WP_001144202.1.67975 WP_001144202.1.67984 WP_001144202.1.67992 WP_001144202.1.68008 WP_001144202.1.6803 WP_001144202.1.68052 WP_001144202.1.68053 WP_001144202.1.68058 WP_001144202.1.68059 WP_001144202.1.68063 WP_001144202.1.68069 WP_001144202.1.68070 WP_001144202.1.68071 WP_001144202.1.6810 WP_001144202.1.68108 WP_001144202.1.68126 WP_001144202.1.68138 WP_001144202.1.68145 WP_001144202.1.68170 WP_001144202.1.68200 WP_001144202.1.68215 WP_001144202.1.68231 WP_001144202.1.68279 WP_001144202.1.68281 WP_001144202.1.68292 WP_001144202.1.68341 WP_001144202.1.68369 WP_001144202.1.68372 WP_001144202.1.68395 WP_001144202.1.68441 WP_001144202.1.68482 WP_001144202.1.68490 WP_001144202.1.68584 WP_001144202.1.6859 WP_001144202.1.68598 WP_001144202.1.68630 WP_001144202.1.68635 WP_001144202.1.68697 WP_001144202.1.68711 WP_001144202.1.68735 WP_001144202.1.68750 WP_001144202.1.68752 WP_001144202.1.68793 WP_001144202.1.68797 WP_001144202.1.68838 WP_001144202.1.68873 WP_001144202.1.68877 WP_001144202.1.68880 WP_001144202.1.68911 WP_001144202.1.68915 WP_001144202.1.68924 WP_001144202.1.68961 WP_001144202.1.6897 WP_001144202.1.68989 WP_001144202.1.69033 WP_001144202.1.69039 WP_001144202.1.69158 WP_001144202.1.6916 WP_001144202.1.69160 WP_001144202.1.6919 WP_001144202.1.69192 WP_001144202.1.6921 WP_001144202.1.69221 WP_001144202.1.69261 WP_001144202.1.6929 WP_001144202.1.69303 WP_001144202.1.69305 WP_001144202.1.69327 WP_001144202.1.69341 WP_001144202.1.69382 WP_001144202.1.69404 WP_001144202.1.69438 WP_001144202.1.69441 WP_001144202.1.6945 WP_001144202.1.69450 WP_001144202.1.69473 WP_001144202.1.69502 WP_001144202.1.69506 WP_001144202.1.69537 WP_001144202.1.69569 WP_001144202.1.69583 WP_001144202.1.69596 WP_001144202.1.69605 WP_001144202.1.69646 WP_001144202.1.69655 WP_001144202.1.697 WP_001144202.1.69730 WP_001144202.1.69735 WP_001144202.1.69803 WP_001144202.1.69832 WP_001144202.1.69868 WP_001144202.1.69963 WP_001144202.1.69979 WP_001144202.1.69999 WP_001144202.1.70041 WP_001144202.1.70081 WP_001144202.1.701 WP_001144202.1.7013 WP_001144202.1.7015 WP_001144202.1.70190 WP_001144202.1.70191 WP_001144202.1.70230 WP_001144202.1.70251 WP_001144202.1.70300 WP_001144202.1.70337 WP_001144202.1.70341 WP_001144202.1.70370 WP_001144202.1.70386 WP_001144202.1.70407 WP_001144202.1.70408 WP_001144202.1.70509 WP_001144202.1.70530 WP_001144202.1.70563 WP_001144202.1.70597 WP_001144202.1.70600 WP_001144202.1.70655 WP_001144202.1.70698 WP_001144202.1.70728 WP_001144202.1.70747 WP_001144202.1.70767 WP_001144202.1.70794 WP_001144202.1.70880 WP_001144202.1.70896 WP_001144202.1.7102 WP_001144202.1.71024 WP_001144202.1.71037 WP_001144202.1.71144 WP_001144202.1.71158 WP_001144202.1.71159 WP_001144202.1.71170 WP_001144202.1.71176 WP_001144202.1.71223 WP_001144202.1.71229 WP_001144202.1.71264 WP_001144202.1.71273 WP_001144202.1.71287 WP_001144202.1.71312 WP_001144202.1.71323 WP_001144202.1.71397 WP_001144202.1.71405 WP_001144202.1.71421 WP_001144202.1.7147 WP_001144202.1.71480 WP_001144202.1.71522 WP_001144202.1.71533 WP_001144202.1.71538 WP_001144202.1.71560 WP_001144202.1.71562 WP_001144202.1.71607 WP_001144202.1.71632 WP_001144202.1.71690 WP_001144202.1.71712 WP_001144202.1.71724 WP_001144202.1.71783 WP_001144202.1.71830 WP_001144202.1.71832 WP_001144202.1.71837 WP_001144202.1.71922 WP_001144202.1.71938 WP_001144202.1.71939 WP_001144202.1.71944 WP_001144202.1.71945 WP_001144202.1.71967 WP_001144202.1.71972 WP_001144202.1.71975 WP_001144202.1.71993 WP_001144202.1.72048 WP_001144202.1.7205 WP_001144202.1.72054 WP_001144202.1.72098 WP_001144202.1.7210 WP_001144202.1.72117 WP_001144202.1.72120 WP_001144202.1.72126 WP_001144202.1.72155 WP_001144202.1.72157 WP_001144202.1.72161 WP_001144202.1.72184 WP_001144202.1.72208 WP_001144202.1.72248 WP_001144202.1.72258 WP_001144202.1.72262 WP_001144202.1.72290 WP_001144202.1.72293 WP_001144202.1.72298 WP_001144202.1.723 WP_001144202.1.72337 WP_001144202.1.72342 WP_001144202.1.72352 WP_001144202.1.72362 WP_001144202.1.72391 WP_001144202.1.72392 WP_001144202.1.72397 WP_001144202.1.72414 WP_001144202.1.72425 WP_001144202.1.72431 WP_001144202.1.72436 WP_001144202.1.72449 WP_001144202.1.72485 WP_001144202.1.72507 WP_001144202.1.72511 WP_001144202.1.72537 WP_001144202.1.72551 WP_001144202.1.72574 WP_001144202.1.72582 WP_001144202.1.72588 WP_001144202.1.72593 WP_001144202.1.72596 WP_001144202.1.72599 WP_001144202.1.72615 WP_001144202.1.72616 WP_001144202.1.72619 WP_001144202.1.72651 WP_001144202.1.72698 WP_001144202.1.72706 WP_001144202.1.72738 WP_001144202.1.72747 WP_001144202.1.72748 WP_001144202.1.72778 WP_001144202.1.72804 WP_001144202.1.72806 WP_001144202.1.72857 WP_001144202.1.72860 WP_001144202.1.72893 WP_001144202.1.72910 WP_001144202.1.72950 WP_001144202.1.72956 WP_001144202.1.72962 WP_001144202.1.72998 WP_001144202.1.73000 WP_001144202.1.73015 WP_001144202.1.73061 WP_001144202.1.7307 WP_001144202.1.73072 WP_001144202.1.73085 WP_001144202.1.7309 WP_001144202.1.73193 WP_001144202.1.73217 WP_001144202.1.73277 WP_001144202.1.73278 WP_001144202.1.73283 WP_001144202.1.73333 WP_001144202.1.73385 WP_001144202.1.73430 WP_001144202.1.73498 WP_001144202.1.73524 WP_001144202.1.73565 WP_001144202.1.73572 WP_001144202.1.73592 WP_001144202.1.73604 WP_001144202.1.73631 WP_001144202.1.73652 WP_001144202.1.73717 WP_001144202.1.73748 WP_001144202.1.73783 WP_001144202.1.73811 WP_001144202.1.73835 WP_001144202.1.73844 WP_001144202.1.73846 WP_001144202.1.73859 WP_001144202.1.73942 WP_001144202.1.73980 WP_001144202.1.74032 WP_001144202.1.74041 WP_001144202.1.74045 WP_001144202.1.74046 WP_001144202.1.74053 WP_001144202.1.7407 WP_001144202.1.74185 WP_001144202.1.74213 WP_001144202.1.74223 WP_001144202.1.74243 WP_001144202.1.74294 WP_001144202.1.74309 WP_001144202.1.74358 WP_001144202.1.74365 WP_001144202.1.74367 WP_001144202.1.744 WP_001144202.1.74426 WP_001144202.1.74445 WP_001144202.1.74465 WP_001144202.1.74509 WP_001144202.1.74528 WP_001144202.1.74549 WP_001144202.1.74574 WP_001144202.1.7461 WP_001144202.1.74623 WP_001144202.1.74624 WP_001144202.1.74688 WP_001144202.1.74691 WP_001144202.1.7471 WP_001144202.1.74713 WP_001144202.1.74716 WP_001144202.1.74720 WP_001144202.1.7475 WP_001144202.1.74767 WP_001144202.1.7479 WP_001144202.1.74793 WP_001144202.1.74867 WP_001144202.1.74873 WP_001144202.1.74879 WP_001144202.1.74880 WP_001144202.1.74889 WP_001144202.1.74914 WP_001144202.1.74915 WP_001144202.1.74962 WP_001144202.1.74975 WP_001144202.1.74993 WP_001144202.1.74998 WP_001144202.1.75003 WP_001144202.1.75118 WP_001144202.1.75124 WP_001144202.1.75138 WP_001144202.1.75139 WP_001144202.1.75143 WP_001144202.1.75155 WP_001144202.1.7516 WP_001144202.1.75218 WP_001144202.1.75221 WP_001144202.1.75228 WP_001144202.1.75243 WP_001144202.1.75247 WP_001144202.1.75272 WP_001144202.1.75306 WP_001144202.1.75367 WP_001144202.1.75491 WP_001144202.1.75505 WP_001144202.1.75537 WP_001144202.1.75557 WP_001144202.1.75568 WP_001144202.1.75602 WP_001144202.1.75612 WP_001144202.1.75644 WP_001144202.1.75653 WP_001144202.1.75679 WP_001144202.1.75698 WP_001144202.1.75699 WP_001144202.1.75725 WP_001144202.1.75786 WP_001144202.1.75803 WP_001144202.1.75839 WP_001144202.1.75853 WP_001144202.1.75892 WP_001144202.1.75918 WP_001144202.1.75983 WP_001144202.1.75995 WP_001144202.1.76005 WP_001144202.1.76039 WP_001144202.1.76057 WP_001144202.1.76089 WP_001144202.1.76118 WP_001144202.1.76119 WP_001144202.1.76184 WP_001144202.1.76194 WP_001144202.1.76268 WP_001144202.1.76269 WP_001144202.1.76305 WP_001144202.1.76312 WP_001144202.1.76325 WP_001144202.1.76335 WP_001144202.1.7637 WP_001144202.1.76376 WP_001144202.1.76446 WP_001144202.1.76447 WP_001144202.1.76452 WP_001144202.1.76460 WP_001144202.1.76462 WP_001144202.1.76466 WP_001144202.1.76469 WP_001144202.1.76504 WP_001144202.1.76544 WP_001144202.1.76595 WP_001144202.1.76596 WP_001144202.1.76612 WP_001144202.1.76643 WP_001144202.1.76660 WP_001144202.1.76701 WP_001144202.1.76705 WP_001144202.1.76751 WP_001144202.1.76759 WP_001144202.1.7680 WP_001144202.1.76815 WP_001144202.1.76831 WP_001144202.1.76884 WP_001144202.1.7689 WP_001144202.1.76948 WP_001144202.1.76957 WP_001144202.1.76961 WP_001144202.1.76994 WP_001144202.1.77007 WP_001144202.1.77015 WP_001144202.1.77036 WP_001144202.1.77057 WP_001144202.1.77081 WP_001144202.1.77120 WP_001144202.1.77134 WP_001144202.1.77198 WP_001144202.1.77214 WP_001144202.1.77253 WP_001144202.1.77288 WP_001144202.1.7729 WP_001144202.1.77290 WP_001144202.1.77296 WP_001144202.1.77326 WP_001144202.1.77358 WP_001144202.1.77391 WP_001144202.1.77408 WP_001144202.1.77419 WP_001144202.1.77432 WP_001144202.1.77448 WP_001144202.1.77455 WP_001144202.1.7747 WP_001144202.1.77470 WP_001144202.1.77481 WP_001144202.1.77487 WP_001144202.1.775 WP_001144202.1.7750 WP_001144202.1.77511 WP_001144202.1.77542 WP_001144202.1.7756 WP_001144202.1.77577 WP_001144202.1.77595 WP_001144202.1.77600 WP_001144202.1.77632 WP_001144202.1.77636 WP_001144202.1.77643 WP_001144202.1.77648 WP_001144202.1.77657 WP_001144202.1.77725 WP_001144202.1.77741 WP_001144202.1.77767 WP_001144202.1.77768 WP_001144202.1.77816 WP_001144202.1.77876 WP_001144202.1.7795 WP_001144202.1.77950 WP_001144202.1.78000 WP_001144202.1.78041 WP_001144202.1.78059 WP_001144202.1.7806 WP_001144202.1.78089 WP_001144202.1.78097 WP_001144202.1.78101 WP_001144202.1.78131 WP_001144202.1.78187 WP_001144202.1.78196 WP_001144202.1.78202 WP_001144202.1.78232 WP_001144202.1.78233 WP_001144202.1.78297 WP_001144202.1.78321 WP_001144202.1.78340 WP_001144202.1.78368 WP_001144202.1.78377 WP_001144202.1.78390 WP_001144202.1.78413 WP_001144202.1.78453 WP_001144202.1.78462 WP_001144202.1.78463 WP_001144202.1.7847 WP_001144202.1.78477 WP_001144202.1.7851 WP_001144202.1.78512 WP_001144202.1.78553 WP_001144202.1.78572 WP_001144202.1.78583 WP_001144202.1.78612 WP_001144202.1.78615 WP_001144202.1.78622 WP_001144202.1.78677 WP_001144202.1.78687 WP_001144202.1.78689 WP_001144202.1.78696 WP_001144202.1.78714 WP_001144202.1.78746 WP_001144202.1.78750 WP_001144202.1.78773 WP_001144202.1.78791 WP_001144202.1.78895 WP_001144202.1.78953 WP_001144202.1.78955 WP_001144202.1.78956 WP_001144202.1.7896 WP_001144202.1.7898 WP_001144202.1.78996 WP_001144202.1.79001 WP_001144202.1.79002 WP_001144202.1.79004 WP_001144202.1.79086 WP_001144202.1.79088 WP_001144202.1.79090 WP_001144202.1.79092 WP_001144202.1.79100 WP_001144202.1.79126 WP_001144202.1.79137 WP_001144202.1.79159 WP_001144202.1.79226 WP_001144202.1.79233 WP_001144202.1.79246 WP_001144202.1.79248 WP_001144202.1.79249 WP_001144202.1.79306 WP_001144202.1.79308 WP_001144202.1.79312 WP_001144202.1.79348 WP_001144202.1.79365 WP_001144202.1.79368 WP_001144202.1.79389 WP_001144202.1.79409 WP_001144202.1.79416 WP_001144202.1.79443 WP_001144202.1.7952 WP_001144202.1.79558 WP_001144202.1.79640 WP_001144202.1.7967 WP_001144202.1.79685 WP_001144202.1.79707 WP_001144202.1.79749 WP_001144202.1.79759 WP_001144202.1.79764 WP_001144202.1.79840 WP_001144202.1.79869 WP_001144202.1.7987 WP_001144202.1.79871 WP_001144202.1.79931 WP_001144202.1.79944 WP_001144202.1.79952 WP_001144202.1.79955 WP_001144202.1.79995 WP_001144202.1.80011 WP_001144202.1.8004 WP_001144202.1.80063 WP_001144202.1.80106 WP_001144202.1.80168 WP_001144202.1.80183 WP_001144202.1.80192 WP_001144202.1.80255 WP_001144202.1.80292 WP_001144202.1.80310 WP_001144202.1.80320 WP_001144202.1.80343 WP_001144202.1.80388 WP_001144202.1.804 WP_001144202.1.80428 WP_001144202.1.80440 WP_001144202.1.80456 WP_001144202.1.80463 WP_001144202.1.80517 WP_001144202.1.80545 WP_001144202.1.80558 WP_001144202.1.80559 WP_001144202.1.8057 WP_001144202.1.80594 WP_001144202.1.80676 WP_001144202.1.8068 WP_001144202.1.80718 WP_001144202.1.80731 WP_001144202.1.80736 WP_001144202.1.8074 WP_001144202.1.8076 WP_001144202.1.808 WP_001144202.1.80843 WP_001144202.1.80862 WP_001144202.1.80882 WP_001144202.1.80884 WP_001144202.1.8090 WP_001144202.1.8091 WP_001144202.1.80935 WP_001144202.1.80948 WP_001144202.1.80954 WP_001144202.1.80966 WP_001144202.1.81036 WP_001144202.1.81071 WP_001144202.1.81098 WP_001144202.1.81156 WP_001144202.1.8118 WP_001144202.1.81180 WP_001144202.1.81186 WP_001144202.1.81266 WP_001144202.1.81267 WP_001144202.1.81281 WP_001144202.1.81298 WP_001144202.1.81313 WP_001144202.1.81323 WP_001144202.1.81347 WP_001144202.1.81396 WP_001144202.1.814 WP_001144202.1.81418 WP_001144202.1.81423 WP_001144202.1.8156 WP_001144202.1.81576 WP_001144202.1.81577 WP_001144202.1.81582 WP_001144202.1.81589 WP_001144202.1.81602 WP_001144202.1.81624 WP_001144202.1.81688 WP_001144202.1.81692 WP_001144202.1.81715 WP_001144202.1.8172 WP_001144202.1.81819 WP_001144202.1.8183 WP_001144202.1.81832 WP_001144202.1.81843 WP_001144202.1.81876 WP_001144202.1.81881 WP_001144202.1.81888 WP_001144202.1.81939 WP_001144202.1.81952 WP_001144202.1.81956 WP_001144202.1.82008 WP_001144202.1.82032 WP_001144202.1.82061 WP_001144202.1.82062 WP_001144202.1.82095 WP_001144202.1.82104 WP_001144202.1.82116 WP_001144202.1.82166 WP_001144202.1.82221 WP_001144202.1.82275 WP_001144202.1.82280 WP_001144202.1.82316 WP_001144202.1.82320 WP_001144202.1.8235 WP_001144202.1.82438 WP_001144202.1.82439 WP_001144202.1.82507 WP_001144202.1.82514 WP_001144202.1.82539 WP_001144202.1.82589 WP_001144202.1.82614 WP_001144202.1.82647 WP_001144202.1.82661 WP_001144202.1.82682 WP_001144202.1.82691 WP_001144202.1.82698 WP_001144202.1.82700 WP_001144202.1.82705 WP_001144202.1.82711 WP_001144202.1.82715 WP_001144202.1.82718 WP_001144202.1.82754 WP_001144202.1.82776 WP_001144202.1.82780 WP_001144202.1.82784 WP_001144202.1.82808 WP_001144202.1.82901 WP_001144202.1.82923 WP_001144202.1.83020 WP_001144202.1.83033 WP_001144202.1.83051 WP_001144202.1.8308 WP_001144202.1.831 WP_001144202.1.83140 WP_001144202.1.83151 WP_001144202.1.83160 WP_001144202.1.83177 WP_001144202.1.83214 WP_001144202.1.83218 WP_001144202.1.83224 WP_001144202.1.83238 WP_001144202.1.83256 WP_001144202.1.83286 WP_001144202.1.83313 WP_001144202.1.83321 WP_001144202.1.83340 WP_001144202.1.83393 WP_001144202.1.8345 WP_001144202.1.83466 WP_001144202.1.83544 WP_001144202.1.83582 WP_001144202.1.83644 WP_001144202.1.83660 WP_001144202.1.83668 WP_001144202.1.8368 WP_001144202.1.83735 WP_001144202.1.8384 WP_001144202.1.83879 WP_001144202.1.83911 WP_001144202.1.83941 WP_001144202.1.84014 WP_001144202.1.8405 WP_001144202.1.84059 WP_001144202.1.84074 WP_001144202.1.8408 WP_001144202.1.8411 WP_001144202.1.84164 WP_001144202.1.84197 WP_001144202.1.84221 WP_001144202.1.84319 WP_001144202.1.84326 WP_001144202.1.84331 WP_001144202.1.84402 WP_001144202.1.84405 WP_001144202.1.84410 WP_001144202.1.8444 WP_001144202.1.84462 WP_001144202.1.84476 WP_001144202.1.84486 WP_001144202.1.84518 WP_001144202.1.84534 WP_001144202.1.84584 WP_001144202.1.84675 WP_001144202.1.84731 WP_001144202.1.84738 WP_001144202.1.84768 WP_001144202.1.84877 WP_001144202.1.84878 WP_001144202.1.84916 WP_001144202.1.84948 WP_001144202.1.84977 WP_001144202.1.84986 WP_001144202.1.84990 WP_001144202.1.84994 WP_001144202.1.85002 WP_001144202.1.85008 WP_001144202.1.85025 WP_001144202.1.85048 WP_001144202.1.85052 WP_001144202.1.85077 WP_001144202.1.85085 WP_001144202.1.85090 WP_001144202.1.85106 WP_001144202.1.85125 WP_001144202.1.85141 WP_001144202.1.85156 WP_001144202.1.8517 WP_001144202.1.85188 WP_001144202.1.85241 WP_001144202.1.85247 WP_001144202.1.85252 WP_001144202.1.85255 WP_001144202.1.85260 WP_001144202.1.8530 WP_001144202.1.85305 WP_001144202.1.85310 WP_001144202.1.85315 WP_001144202.1.85320 WP_001144202.1.85336 WP_001144202.1.85361 WP_001144202.1.85369 WP_001144202.1.85384 WP_001144202.1.85385 WP_001144202.1.85416 WP_001144202.1.85546 WP_001144202.1.85556 WP_001144202.1.85563 WP_001144202.1.85578 WP_001144202.1.85593 WP_001144202.1.8560 WP_001144202.1.85601 WP_001144202.1.85621 WP_001144202.1.8564 WP_001144202.1.85685 WP_001144202.1.85752 WP_001144202.1.85767 WP_001144202.1.85781 WP_001144202.1.85793 WP_001144202.1.85800 WP_001144202.1.85806 WP_001144202.1.85857 WP_001144202.1.85895 WP_001144202.1.8592 WP_001144202.1.85948 WP_001144202.1.85969 WP_001144202.1.86001 WP_001144202.1.8603 WP_001144202.1.86063 WP_001144202.1.86110 WP_001144202.1.86145 WP_001144202.1.86176 WP_001144202.1.86189 WP_001144202.1.86196 WP_001144202.1.8621 WP_001144202.1.86227 WP_001144202.1.86234 WP_001144202.1.86261 WP_001144202.1.86273 WP_001144202.1.86276 WP_001144202.1.86280 WP_001144202.1.86294 WP_001144202.1.8635 WP_001144202.1.86412 WP_001144202.1.86437 WP_001144202.1.86452 WP_001144202.1.86461 WP_001144202.1.86475 WP_001144202.1.86483 WP_001144202.1.86518 WP_001144202.1.8656 WP_001144202.1.86560 WP_001144202.1.86586 WP_001144202.1.86598 WP_001144202.1.86609 WP_001144202.1.86613 WP_001144202.1.86627 WP_001144202.1.86681 WP_001144202.1.86691 WP_001144202.1.86731 WP_001144202.1.86734 WP_001144202.1.86753 WP_001144202.1.86768 WP_001144202.1.86787 WP_001144202.1.86788 WP_001144202.1.8679 WP_001144202.1.86846 WP_001144202.1.86848 WP_001144202.1.86935 WP_001144202.1.86959 WP_001144202.1.86975 WP_001144202.1.86997 WP_001144202.1.8705 WP_001144202.1.87059 WP_001144202.1.87067 WP_001144202.1.87074 WP_001144202.1.87102 WP_001144202.1.87147 WP_001144202.1.87177 WP_001144202.1.87199 WP_001144202.1.87339 WP_001144202.1.87389 WP_001144202.1.87443 WP_001144202.1.87491 WP_001144202.1.87504 WP_001144202.1.87563 WP_001144202.1.87574 WP_001144202.1.87590 WP_001144202.1.87608 WP_001144202.1.87610 WP_001144202.1.87635 WP_001144202.1.87655 WP_001144202.1.87675 WP_001144202.1.87696 WP_001144202.1.8771 WP_001144202.1.87721 WP_001144202.1.87738 WP_001144202.1.87766 WP_001144202.1.87786 WP_001144202.1.87857 WP_001144202.1.87914 WP_001144202.1.87984 WP_001144202.1.87990 WP_001144202.1.880 WP_001144202.1.88017 WP_001144202.1.88066 WP_001144202.1.88082 WP_001144202.1.88110 WP_001144202.1.88147 WP_001144202.1.88234 WP_001144202.1.88260 WP_001144202.1.88301 WP_001144202.1.88352 WP_001144202.1.88413 WP_001144202.1.88434 WP_001144202.1.88438 WP_001144202.1.88467 WP_001144202.1.88505 WP_001144202.1.8854 WP_001144202.1.88562 WP_001144202.1.88577 WP_001144202.1.88678 WP_001144202.1.88685 WP_001144202.1.88686 WP_001144202.1.88711 WP_001144202.1.88717 WP_001144202.1.88720 WP_001144202.1.88729 WP_001144202.1.8873 WP_001144202.1.88735 WP_001144202.1.88767 WP_001144202.1.8879 WP_001144202.1.88793 WP_001144202.1.88826 WP_001144202.1.88834 WP_001144202.1.88864 WP_001144202.1.88941 WP_001144202.1.88953 WP_001144202.1.88961 WP_001144202.1.89018 WP_001144202.1.89043 WP_001144202.1.8906 WP_001144202.1.89069 WP_001144202.1.89090 WP_001144202.1.89099 WP_001144202.1.89111 WP_001144202.1.89150 WP_001144202.1.89163 WP_001144202.1.89217 WP_001144202.1.8928 WP_001144202.1.89285 WP_001144202.1.89312 WP_001144202.1.89334 WP_001144202.1.89351 WP_001144202.1.89379 WP_001144202.1.89396 WP_001144202.1.89400 WP_001144202.1.89416 WP_001144202.1.89427 WP_001144202.1.89458 WP_001144202.1.89466 WP_001144202.1.89468 WP_001144202.1.89469 WP_001144202.1.89471 WP_001144202.1.89510 WP_001144202.1.89551 WP_001144202.1.89583 WP_001144202.1.89605 WP_001144202.1.89630 WP_001144202.1.89631 WP_001144202.1.89656 WP_001144202.1.89674 WP_001144202.1.89679 WP_001144202.1.89700 WP_001144202.1.89747 WP_001144202.1.89841 WP_001144202.1.8985 WP_001144202.1.89923 WP_001144202.1.89925 WP_001144202.1.89977 WP_001144202.1.89998 WP_001144202.1.90022 WP_001144202.1.90065 WP_001144202.1.90078 WP_001144202.1.90115 WP_001144202.1.90168 WP_001144202.1.90171 WP_001144202.1.90182 WP_001144202.1.902 WP_001144202.1.90249 WP_001144202.1.90256 WP_001144202.1.90314 WP_001144202.1.90346 WP_001144202.1.90357 WP_001144202.1.90358 WP_001144202.1.9036 WP_001144202.1.9037 WP_001144202.1.90436 WP_001144202.1.90449 WP_001144202.1.90511 WP_001144202.1.90520 WP_001144202.1.90536 WP_001144202.1.90602 WP_001144202.1.90758 WP_001144202.1.90775 WP_001144202.1.90828 WP_001144202.1.90839 WP_001144202.1.9084 WP_001144202.1.90842 WP_001144202.1.9087 WP_001144202.1.90905 WP_001144202.1.90924 WP_001144202.1.90960 WP_001144202.1.90996 WP_001144202.1.91 WP_001144202.1.91007 WP_001144202.1.91010 WP_001144202.1.91117 WP_001144202.1.91121 WP_001144202.1.91138 WP_001144202.1.91170 WP_001144202.1.9118 WP_001144202.1.91182 WP_001144202.1.9119 WP_001144202.1.91213 WP_001144202.1.91220 WP_001144202.1.91277 WP_001144202.1.91340 WP_001144202.1.91341 WP_001144202.1.91361 WP_001144202.1.91414 WP_001144202.1.91425 WP_001144202.1.91445 WP_001144202.1.91462 WP_001144202.1.91482 WP_001144202.1.915 WP_001144202.1.91515 WP_001144202.1.91516 WP_001144202.1.91526 WP_001144202.1.91543 WP_001144202.1.91549 WP_001144202.1.91551 WP_001144202.1.91566 WP_001144202.1.91594 WP_001144202.1.91626 WP_001144202.1.91630 WP_001144202.1.91666 WP_001144202.1.91701 WP_001144202.1.91756 WP_001144202.1.91779 WP_001144202.1.91793 WP_001144202.1.91814 WP_001144202.1.91843 WP_001144202.1.91863 WP_001144202.1.91887 WP_001144202.1.91893 WP_001144202.1.91954 WP_001144202.1.91965 WP_001144202.1.9199 WP_001144202.1.92029 WP_001144202.1.92053 WP_001144202.1.9209 WP_001144202.1.92123 WP_001144202.1.92161 WP_001144202.1.92195 WP_001144202.1.92201 WP_001144202.1.92224 WP_001144202.1.92276 WP_001144202.1.92304 WP_001144202.1.92305 WP_001144202.1.92323 WP_001144202.1.92361 WP_001144202.1.924 WP_001144202.1.92403 WP_001144202.1.92462 WP_001144202.1.92473 WP_001144202.1.92495 WP_001144202.1.92496 WP_001144202.1.92506 WP_001144202.1.92535 WP_001144202.1.92568 WP_001144202.1.92571 WP_001144202.1.92614 WP_001144202.1.92634 WP_001144202.1.92638 WP_001144202.1.92648 WP_001144202.1.92693 WP_001144202.1.92742 WP_001144202.1.92792 WP_001144202.1.92793 WP_001144202.1.92796 WP_001144202.1.92845 WP_001144202.1.92865 WP_001144202.1.92882 WP_001144202.1.92886 WP_001144202.1.92932 WP_001144202.1.92943 WP_001144202.1.92991 WP_001144202.1.93019 WP_001144202.1.93048 WP_001144202.1.93052 WP_001144202.1.93054 WP_001144202.1.93085 WP_001144202.1.93139 WP_001144202.1.93167 WP_001144202.1.93175 WP_001144202.1.93185 WP_001144202.1.93233 WP_001144202.1.93267 WP_001144202.1.93276 WP_001144202.1.93291 WP_001144202.1.9331 WP_001144202.1.93312 WP_001144202.1.934 WP_001144202.1.93431 WP_001144202.1.93453 WP_001144202.1.93461 WP_001144202.1.93468 WP_001144202.1.93552 WP_001144202.1.9356 WP_001144202.1.93605 WP_001144202.1.93621 WP_001144202.1.93626 WP_001144202.1.93634 WP_001144202.1.93652 WP_001144202.1.93673 WP_001144202.1.93679 WP_001144202.1.93694 WP_001144202.1.93737 WP_001144202.1.93742 WP_001144202.1.93755 WP_001144202.1.93765 WP_001144202.1.93768 WP_001144202.1.938 WP_001144202.1.939 WP_001144202.1.93900 WP_001144202.1.93911 WP_001144202.1.93921 WP_001144202.1.93939 WP_001144202.1.93952 WP_001144202.1.93971 WP_001144202.1.94025 WP_001144202.1.94035 WP_001144202.1.94040 WP_001144202.1.94057 WP_001144202.1.94069 WP_001144202.1.9416 WP_001144202.1.94176 WP_001144202.1.94190 WP_001144202.1.9420 WP_001144202.1.94271 WP_001144202.1.94282 WP_001144202.1.94367 WP_001144202.1.94388 WP_001144202.1.94429 WP_001144202.1.94430 WP_001144202.1.94436 WP_001144202.1.94438 WP_001144202.1.94445 WP_001144202.1.94446 WP_001144202.1.94497 WP_001144202.1.94516 WP_001144202.1.94523 WP_001144202.1.9457 WP_001144202.1.94619 WP_001144202.1.94626 WP_001144202.1.94653 WP_001144202.1.94686 WP_001144202.1.94690 WP_001144202.1.94695 WP_001144202.1.94704 WP_001144202.1.94738 WP_001144202.1.94739 WP_001144202.1.9474 WP_001144202.1.94753 WP_001144202.1.94764 WP_001144202.1.948 WP_001144202.1.94801 WP_001144202.1.94823 WP_001144202.1.94836 WP_001144202.1.94841 WP_001144202.1.94847 WP_001144202.1.94869 WP_001144202.1.94877 WP_001144202.1.9489 WP_001144202.1.94898 WP_001144202.1.949 WP_001144202.1.94927 WP_001144202.1.94938 WP_001144202.1.94949 WP_001144202.1.94963 WP_001144202.1.95036 WP_001144202.1.95037 WP_001144202.1.95080 WP_001144202.1.95084 WP_001144202.1.95233 WP_001144202.1.95254 WP_001144202.1.95310 WP_001144202.1.95364 WP_001144202.1.95395 WP_001144202.1.95398 WP_001144202.1.95403 WP_001144202.1.95431 WP_001144202.1.95518 WP_001144202.1.95595 WP_001144202.1.95596 WP_001144202.1.95628 WP_001144202.1.95634 WP_001144202.1.95712 WP_001144202.1.95756 WP_001144202.1.95759 WP_001144202.1.95784 WP_001144202.1.95801 WP_001144202.1.95821 WP_001144202.1.95827 WP_001144202.1.95835 WP_001144202.1.95846 WP_001144202.1.95849 WP_001144202.1.95858 WP_001144202.1.95861 WP_001144202.1.95919 WP_001144202.1.95931 WP_001144202.1.95951 WP_001144202.1.96032 WP_001144202.1.96059 WP_001144202.1.96097 WP_001144202.1.96110 WP_001144202.1.96128 WP_001144202.1.96143 WP_001144202.1.96215 WP_001144202.1.96253 WP_001144202.1.96279 WP_001144202.1.96293 WP_001144202.1.96299 WP_001144202.1.96303 WP_001144202.1.9631 WP_001144202.1.96339 WP_001144202.1.96378 WP_001144202.1.96392 WP_001144202.1.96394 WP_001144202.1.96417 WP_001144202.1.96420 WP_001144202.1.96478 WP_001144202.1.96484 WP_001144202.1.9649 WP_001144202.1.96519 WP_001144202.1.96558 WP_001144202.1.96608 WP_001144202.1.96617 WP_001144202.1.96633 WP_001144202.1.96650 WP_001144202.1.96659 WP_001144202.1.96676 WP_001144202.1.9668 WP_001144202.1.96680 WP_001144202.1.96683 WP_001144202.1.96695 WP_001144202.1.96701 WP_001144202.1.96753 WP_001144202.1.96759 WP_001144202.1.96762 WP_001144202.1.96769 WP_001144202.1.96779 WP_001144202.1.96797 WP_001144202.1.9682 WP_001144202.1.96820 WP_001144202.1.96850 WP_001144202.1.96864 WP_001144202.1.96894 WP_001144202.1.96907 WP_001144202.1.96932 WP_001144202.1.96971 WP_001144202.1.96984 WP_001144202.1.96989 WP_001144202.1.97011 WP_001144202.1.9708 WP_001144202.1.97123 WP_001144202.1.97195 WP_001144202.1.9723 WP_001144202.1.97231 WP_001144202.1.97269 WP_001144202.1.97279 WP_001144202.1.97282 WP_001144202.1.97292 WP_001144202.1.97379 WP_001144202.1.97387 WP_001144202.1.97418 WP_001144202.1.9747 WP_001144202.1.97525 WP_001144202.1.97527 WP_001144202.1.97549 WP_001144202.1.97571 WP_001144202.1.97619 WP_001144202.1.97667 WP_001144202.1.97675 WP_001144202.1.97711 WP_001144202.1.97775 WP_001144202.1.97778 WP_001144202.1.978 WP_001144202.1.97802 WP_001144202.1.97815 WP_001144202.1.97890 WP_001144202.1.97895 WP_001144202.1.97919 WP_001144202.1.97930 WP_001144202.1.98000 WP_001144202.1.98102 WP_001144202.1.98167 WP_001144202.1.98208 WP_001144202.1.98235 WP_001144202.1.98244 WP_001144202.1.98284 WP_001144202.1.98294 WP_001144202.1.98323 WP_001144202.1.98355 WP_001144202.1.98424 WP_001144202.1.98429 WP_001144202.1.98442 WP_001144202.1.98477 WP_001144202.1.98484 WP_001144202.1.98498 WP_001144202.1.98626 WP_001144202.1.98628 WP_001144202.1.98641 WP_001144202.1.98668 WP_001144202.1.98727 WP_001144202.1.98775 WP_001144202.1.98776 WP_001144202.1.98784 WP_001144202.1.98795 WP_001144202.1.98849 WP_001144202.1.98886 WP_001144202.1.98908 WP_001144202.1.98976 WP_001144202.1.99006 WP_001144202.1.99053 WP_001144202.1.99060 WP_001144202.1.9907 WP_001144202.1.99110 WP_001144202.1.99119 WP_001144202.1.9930 WP_001144202.1.99306 WP_001144202.1.99349 WP_001144202.1.99366 WP_001144202.1.99401 WP_001144202.1.99427 WP_001144202.1.99453 WP_001144202.1.99458 WP_001144202.1.99472 WP_001144202.1.9950 WP_001144202.1.99534 WP_001144202.1.99549 WP_001144202.1.99571 WP_001144202.1.99602 WP_001144202.1.99603 WP_001144202.1.99641 WP_001144202.1.99694 WP_001144202.1.99734 WP_001144202.1.99774 WP_001144202.1.99782 WP_001144202.1.99791 WP_001144202.1.99874 WP_001144202.1.99891 WP_001144202.1.99892 WP_001144202.1.99912 YP_002407343.1.10275 YP_002412737.1.14968 198214.SF1512 198215.S1630 199310.c2116 300269.SSON_1439 316385.ECDH10B_1855 316407.thrS 362663.ECP_1666 364106.UTI89_C1912 373384.SFV_1504 405955.APECO1_791 413997.ECB_01688 439855.EcSMS35_1472 469008.ECBD_1926 511145.b1719 574521.E2348C_1848 585035.ECS88_1769 585056.ECUMN_2009 585057.ECIAI39_1335 585397.ECED1_1920 595496.BWG_1533 gi|383178164|ref|YP_005456169.1| gi|222156469|ref|YP_002556608.1| gi|253773326|ref|YP_003036157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]