SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qobA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qobA
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.95e-52
Family 2Fe-2S ferredoxin-related 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qobA   PDB: 1qob   SUPERFAMILY: 1qobA
Sequence length 98
Comment (A:)
Sequence
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
skqsfldddqieagyvltcvayptsdvviqthkeedly
Download sequence
Identical sequences 1qobA cath|current|1qobA00/1-98 cath|current|1qobB00/1-98 d1qoba_ d1qobb_ 1qob_A 1qob_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]