SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qofA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qofA
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.1e-52
Family 2Fe-2S ferredoxin-related 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qofA   PDB: 1qof   SUPERFAMILY: 1qofA
Sequence length 98
Comment (A:)
Sequence
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddkieagyvltcvayptsdvviqthkeedly
Download sequence
Identical sequences 1qof_A 1qof_B 1qofA cath|current|1qofA00/1-98 cath|current|1qofB00/1-98 d1qofa_ d1qofb_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]