SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qogA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qogA
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.71e-52
Family 2Fe-2S ferredoxin-related 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qogA   PDB: 1qog   SUPERFAMILY: 1qogA
Sequence length 98
Comment (A:)
Sequence
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacatcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly
Download sequence
Identical sequences cath|current|1qogA00/1-98 cath|current|1qogB00/1-98 d1qoga_ d1qogb_ 1qog_A 1qog_B 1qogA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]