SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qpbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qpbA
Domain Number 1 Region: 364-542
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.15e-54
Family Pyruvate oxidase and decarboxylase PP module 0.00065
Further Details:      
 
Domain Number 2 Region: 4-183
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.11e-42
Family Pyruvate oxidase and decarboxylase Pyr module 0.01
Further Details:      
 
Domain Number 3 Region: 198-339
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.37e-42
Family Pyruvate oxidase and decarboxylase, middle domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qpbA   PDB: 1qpb
Sequence length 563
Comment (A:)
Sequence
mseitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadg
yarikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsisaqakqlllhhtlgng
dftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakl
lqtpidmslkpndaesekevidtilvlikdaknpviladaccsrhdvkaetkklidltqf
pafvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsys
yktknivefhsdhmkirnatfpgvqmkfvlqklltaiadaakgykpvavpartpanaavp
astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmievml
pvfdapqnlveqakltaatnakq
Download sequence
Identical sequences 1qpb_A 1qpb_B 1qpbA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]