SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qrbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qrbA
Domain Number 1 Region: 6-559
Classification Level Classification E-value
Superfamily Pectin lyase-like 0
Family P22 tailspike protein 0.000000000000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qrbA   PDB: 1qrb   SUPERFAMILY: 1qrbA
Sequence length 559
Comment (A:)
Sequence
ydpdqysieadkkfkysvklsdyptlqdaasaavdgllidrdynfyggetvdfggkvlti
eckakfigdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqs
ktdgyqptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgc
hfckmvdannpsggkdgiitfenlsgdwgkgnyviggrfsygsvssaqflrnnggferdg
gvigftsyragesgvktwqgtvgsttsrnynlqfrdsvviypvwdgfdlgadtdmnpeld
rpgdypitqyplhqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllt
hesvftniaiidtntkdfqanqiyisgacrvnglrligirstdgqsltidapnstvsgit
gmvdpsrinvanlaeeglgniransfgydsaaiklrihklsktldsgalyshinggagsg
saytqltaisgstpdavslkvnhkdcrgaeipfvpdiasddfikdsscflpywennstsl
kalvkkpngelvrltlatl
Download sequence
Identical sequences 1qrbA cath|current|1qrbA00/113-666 1qrb_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]