SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qs0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qs0A
Domain Number 1 Region: 2-406
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.06e-95
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000000000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qs0A   PDB: 1qs0   SUPERFAMILY: 1qs0A
Sequence length 407
Comment (A:)
Sequence
neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel
Download sequence
Identical sequences 1qs0A 1qs0_A 000010705|e1qs0A1|2111.75.1.3|A:1-407 000111102|e2bp7C1|2111.75.1.3|C:2-408 000111103|e2bp7A1|2111.75.1.3|A:2-408 000111104|e2bp7E1|2111.75.1.3|E:2-408 000111105|e2bp7G1|2111.75.1.3|G:2-408 d1qs0a_ d2bp7a_ d2bp7c_ d2bp7e_ d2bp7g_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]