SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qvtA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qvtA
Domain Number 1 Region: 73-186
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 8.92e-38
Family Tetracyclin repressor-like, C-terminal domain 0.000000678
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000133
Family Tetracyclin repressor-like, N-terminal domain 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qvtA   PDB: 1qvt
Sequence length 194
Comment (A:)
Sequence
mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
wqeqwkkeqikcktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
iflnglskhhhhhh
Download sequence
Identical sequences 1qvt_A 1qvt_B 1qvt_D 1qvt_E 1qvu_A 1qvu_B 1qvu_D 1qvu_E 1qvtA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]