SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qwoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qwoA
Domain Number 1 Region: 6-441
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 9.06e-113
Family Histidine acid phosphatase 0.0000000000000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qwoA   PDB: 1qwo   SUPERFAMILY: 1qwoA
Sequence length 442
Comment (A:)
Sequence
sagskscdtvdlgyqcspatshlwgqyspffsledelsvssklpkdcritlvqvlsrhga
ryptsskskkykklvtaiqanatdfkgkfaflktynytlgaddltpfgeqqlvnsgikfy
qrykalarsvvpfirasgsdrviasgekfiegfqqakladpgatnraapaisviipeset
fnntldhgvctkfeasqlgdevaanftalfapdiraraekhlpgvtltdedvvslmdmcs
fdtvartsdasqlspfcqlfthnewkkynylqslgkyygygagnplgpaqgigftnelia
rltrspvqdhtstnstlvsnpatfplnatmyvdfshdnsmvsiffalglyngteplsrts
vesakeldgysaswvvpfgarayfetmqcksekeplvralindrvvplhgcdvdklgrck
lndfvkglswarsggnwgecfs
Download sequence
Identical sequences 1qwo_A 1qwoA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]