SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1r8dA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1r8dA
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.47e-34
Family DNA-binding N-terminal domain of transcription activators 0.0000877
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1r8dA   PDB: 1r8d   SUPERFAMILY: 1r8dA
Sequence length 109
Comment (A:)
Sequence
mkyqvkqvaeisgvsirtlhhydniellnpsaltdagyrlysdadlerlqqilffkeigf
rldeikemldhpnfdrkaalqsqkeilmkkkqrmdemiqtidrtllsvd
Download sequence
Identical sequences 1r8dA 000002825|e1r8dA1|101.1.9.12|A:1-109 cath|current|1jbgA00/2-107 cath|current|1r8dA00/1-109 cath|current|1r8dB00/1-107 d1r8da_ 1jbg_A 1r8d_A 1r8d_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]