SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1r8eA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1r8eA
Domain Number 1 Region: 121-276
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.83e-53
Family Multidrug-binding domain of transcription activator BmrR 0.0000000497
Further Details:      
 
Domain Number 2 Region: 4-115
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.39e-26
Family DNA-binding N-terminal domain of transcription activators 0.00000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1r8eA   PDB: 1r8e
Sequence length 278
Comment (A:)
Sequence
MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLK
YIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPA
LGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYT
SIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYI
ADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIAE
Download sequence
Identical sequences A0A085C7C8 A0A0T8PUN3 A0A199WK58 D4FYI5 G4EU24 L8AMV5 P39075
1r8eA gi|50812267|ref|NP_390282.2| NP_390282.2.22788 WP_003230325.1.11257 WP_003230325.1.1140 WP_003230325.1.12759 WP_003230325.1.15902 WP_003230325.1.16291 WP_003230325.1.20502 WP_003230325.1.27372 WP_003230325.1.27660 WP_003230325.1.2914 WP_003230325.1.31786 WP_003230325.1.32219 WP_003230325.1.32420 WP_003230325.1.33285 WP_003230325.1.33846 WP_003230325.1.35833 WP_003230325.1.36189 WP_003230325.1.39562 WP_003230325.1.39605 WP_003230325.1.40859 WP_003230325.1.42762 WP_003230325.1.44140 WP_003230325.1.44184 WP_003230325.1.45019 WP_003230325.1.47157 WP_003230325.1.47672 WP_003230325.1.51783 WP_003230325.1.5262 WP_003230325.1.52847 WP_003230325.1.54948 WP_003230325.1.55792 WP_003230325.1.56274 WP_003230325.1.56411 WP_003230325.1.57156 WP_003230325.1.57184 WP_003230325.1.57201 WP_003230325.1.5726 WP_003230325.1.57513 WP_003230325.1.6139 WP_003230325.1.63795 WP_003230325.1.6517 WP_003230325.1.65223 WP_003230325.1.67028 WP_003230325.1.71916 WP_003230325.1.72999 WP_003230325.1.76814 WP_003230325.1.76977 WP_003230325.1.78686 WP_003230325.1.78811 WP_003230325.1.79712 WP_003230325.1.80832 WP_003230325.1.81116 WP_003230325.1.81747 WP_003230325.1.82722 WP_003230325.1.84434 WP_003230325.1.88042 WP_003230325.1.88591 WP_003230325.1.91723 WP_003230325.1.93420 WP_003230325.1.94199 WP_003230325.1.95009 WP_003230325.1.96043 WP_003230325.1.979 1exi_A 1exj_A 1r8e_A gi|560129350|ref|YP_008830491.1| 224308.BSU24020 gi|470162609|ref|YP_007534384.1| gi|428279884|ref|YP_005561619.1| gi|402776664|ref|YP_006630608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]