SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ra0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ra0A
Domain Number 1 Region: 60-379
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 4.29e-108
Family Cytosine deaminase catalytic domain 0.0000000000136
Further Details:      
 
Domain Number 2 Region: 9-68
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.0000000000000396
Family Cytosine deaminase 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ra0A   PDB: 1ra0
Sequence length 430
Comment (A:)
Sequence
gssmannalqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipp
fvephihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangi
qhvrthvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlg
advvgaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhe
gmgarvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgit
rvkemlesginvcfghdgvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithh
sartlnlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyl
eqpeaidykr
Download sequence
Identical sequences 1ra0A 1r9x_A 1ra0_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]