SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rc9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rc9A
Domain Number 1 Region: 9-156
Classification Level Classification E-value
Superfamily PR-1-like 8.79e-64
Family PR-1-like 0.0000261
Further Details:      
 
Domain Number 2 Region: 166-220
Classification Level Classification E-value
Superfamily Crisp domain-like 2.81e-29
Family Crisp domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rc9A   PDB: 1rc9
Sequence length 221
Comment (A:)
Sequence
nvdfdsesprkpeiqneivdlhnslrrsvnptasnmlrmewypeaadnaerwayrciesh
ssyesrviegikcgeniymspypmkwtdiihawhdeykdfkygvgadppnavtghytqiv
wyksyrigcaaaycpsspysyffvcqycpagnfigktatpytsgtpcgdcpsdcdnglct
npctrenkftncntmvqqsscqdnymktncpascfcqnkii
Download sequence
Identical sequences 1rc9_A 1rc9A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]