SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1retA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1retA
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000657
Family Recombinase DNA-binding domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1retA   PDB: 1ret   SUPERFAMILY: 1retA
Sequence length 43
Comment (A:)
Sequence
grkrkidrdavlnmwqqglgashisktmniarstvykvinesn
Download sequence
Identical sequences 1res_A 1ret_A 1retA 000002475|e1gdtA1|101.1.1.22|A:141-183 000045268|e1resA1|101.1.1.22|A:1-43 000045271|e1retA1|101.1.1.22|A:1-43 cath|current|1gdtA03/141-183 cath|current|1resA00/1-43 cath|current|1retA00/1-43 d1gdta1 d1gdtb1 d1resa_ d1reta_ d1zr2a1 d1zr2b1 d1zr4a1 d1zr4b1 d1zr4d1 d1zr4e1 d2gm4a1 d2gm4b1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]