SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1rf8B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rf8B
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain 4.47e-36
Family Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rf8B   PDB: 1rf8   SUPERFAMILY: 1rf8B
Sequence length 100
Comment (B:)
Sequence
gsigleaeietttdetddgtntvshilnvlkdatpiedvfsfnypegiegpdikykkehv
kytygptfllqfkdklnvkadaewvqstaskivippgmgr
Download sequence
Identical sequences 000002387|e1rf8B1|542.1.1.1|B:1-100 1rf8_B 1rf8B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]