SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1riqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1riqA
Domain Number 1 Region: 4-237
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.04e-113
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000283
Further Details:      
 
Domain Number 2 Region: 238-454
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.34e-67
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1riqA   PDB: 1riq
Sequence length 465
Comment (A:)
Sequence
mslsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpyk
ratscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlk
lpkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdr
geeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeid
iifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirril
rramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkag
meyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqcelee
qrerarkhfkveakkvkpvyshlkelgktsafvgaaalehhhhhh
Download sequence
Identical sequences 1riqA 1riq_A 1yfr_A 1yfr_B 1yfs_A 1yfs_B 1yft_A 1ygb_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]