SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rk6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rk6A
Domain Number 1 Region: 75-320,361-432
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 3.38e-106
Family D-aminoacylase, catalytic domain 0.00000000117
Further Details:      
 
Domain Number 2 Region: 435-491
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 7.56e-24
Family D-aminoacylase 0.00037
Further Details:      
 
Domain Number 3 Region: 21-74
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 7.2e-20
Family D-aminoacylase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rk6A   PDB: 1rk6
Sequence length 496
Comment (A:)
Sequence
mrgshhhhhhgsmsqpdatpfdyilsggtvidgtnapgrladvgvrgdriaavgdlsass
arrridvagkvvspgfidshthddnyllkhrdmtpkisqgvttvvtgncgislaplahan
ppapldlldeggsfrfarfsdylealraappavnaacmvghstlraavmpdlrreatade
iqamqaladdalasgaigistgafyppaahasteeiievcrplithggvyathmrdegeh
ivqaleetfrigreldvpvvishhkvmgklnfgrsketlalieaamasqdvsldaypyva
gstmlkqdrvllagrtlitwckpypelsgrdleeiaaergkskydvvpelqpagaiyfmm
depdvqrilafgptmigsdglphderphprlwgtfprvlghysrdlglfpletavwkmtg
ltaakfglaergqvqpgyyadlvvfdpatvadsatfehpteraagihsvyvngaavwedq
sftgqhagrvlnraga
Download sequence
Identical sequences 1rk6A 1rjp_A 1rk6_A 1v51_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]