SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rkwA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rkwA
Domain Number 1 Region: 73-186
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 8.92e-38
Family Tetracyclin repressor-like, C-terminal domain 0.000000678
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000133
Family Tetracyclin repressor-like, N-terminal domain 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rkwA   PDB: 1rkw
Sequence length 194
Comment (A:)
Sequence
mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
iflnglskhhhhhh
Download sequence
Identical sequences 1rkwA 1jt0_A 1jt0_B 1jt0_C 1jt0_D 1jtx_A 1jtx_B 1jtx_D 1jtx_E 1jty_A 1jty_B 1jty_D 1jty_E 1jum_A 1jum_B 1jum_D 1jum_E 1jup_A 1jup_B 1jup_D 1jup_E 1jus_A 1jus_B 1jus_D 1jus_E 1rkw_A 1rkw_B 1rkw_D 1rkw_E 2dtz_A 2dtz_B 2dtz_D 2dtz_E 2gby_A 2gby_B 2gby_D 2gby_E 2hq5_A 2hq5_B 2hq5_D 2hq5_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]