SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rmgA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rmgA
Domain Number 1 Region: 1-421
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.73e-120
Family Galacturonase 0.00000000000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rmgA   PDB: 1rmg   SUPERFAMILY: 1rmgA
Sequence length 422
Comment (A:)
Sequence
qlsgsvgpltsastkgatktcnilsygavadnstdvgpaitsawaacksgglvyipsgny
alntwvtltggsataiqldgiiyrtgtasgnmiavtdttdfelfsstskgavqgfgyvyh
aegtygarilrltdvthfsvhdiilvdapafhftmdtcsdgevynmairggneggldgid
vwgsniwvhdvevtnkdecvtvkspannilvesiycnwsggcamgslgadtdvtdivyrn
vytwssnqmymiksnggsgtvsnvllenfighgnaysldidgywssmtavagdgvqlnni
tvknwkgteangatrppirvvcsdtapctdltlediaiwtesgsselylcrsaygsgycl
kdssshtsytttstvtaapsgysattmaadlatafgltasipiptiptsfypgltpysal
ag
Download sequence
Identical sequences 1rmg_A 000007214|e1rmgA1|207.2.1.28|A:1-422 cath|current|1rmgA00/1-422 d1rmga_ 1rmgA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]