SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rpaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rpaA
Domain Number 1 Region: 2-329
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 1.09e-125
Family Histidine acid phosphatase 0.0000000000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rpaA   PDB: 1rpa   SUPERFAMILY: 1rpaA
Sequence length 342
Comment (A:)
Sequence
kelkfvtlvfrhgdrgpietfpndpikesswpqgfgqltkwgmgqhyelgsyirrrygrf
lnnsykhdqvyirstdvdrtlmsamtnlaalfppegnsiwnprllwqpipvhtvslsedr
llylpfrdcprfqelksetlkseeflkrlqpyksfidtlpslsgfedqdlfeiwsrlydp
lycesvhnftlptwatedamtklkelselsllslygihkqkeksrlqggvlvneilknmk
latqpqkarklimysahdttvsglqmaldvyngllppyaschimelyqdngghfvemyyr
netqnepypltlpgcthscplekfaelldpvipqdwatecmg
Download sequence
Identical sequences 1rpa_A 1rpt_A 000108923|e1rpaA1|2111.21.1.2|A:1-342 000108930|e1rptA1|2111.21.1.2|A:1-342 cath|current|1rpaA00/1-342 cath|current|1rptA00/1-342 d1rpaa_ d1rpta_ 1rpaA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]