SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rplA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rplA
Domain Number 1 Region: 69-249
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.72e-67
Family DNA polymerase beta-like 0.0000000289
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 8.05e-17
Family DNA polymerase beta-like, second domain 0.0000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rplA   PDB: 1rpl
Sequence length 251
Comment (A:)
Sequence
lekirqddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfe
dfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftses
skqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdq
yycgvlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiq
wryrepkdrse
Download sequence
Identical sequences 1rplA 1rpl_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]