SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rr7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rr7A
Domain Number 1 Region: 27-119
Classification Level Classification E-value
Superfamily Homeodomain-like 5.89e-24
Family Middle operon regulator, Mor 0.00000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rr7A   PDB: 1rr7   SUPERFAMILY: 1rr7A
Sequence length 129
Comment (A:)
Sequence
MTEDLFGDLQDDTILAHLDNPAEDTSRFPALLAELNDLLRGELSRLGVDPAHSLEIVVAI
CKHLGGGQVYIPRGQALDSLIRDLRIWNDFNGRNVSELTTRYGVTFNTVYKAIRRMRRLK
YRQYQPSLL
Download sequence
Identical sequences E0J3R4 P23848
gi|378714363|ref|YP_005279256.1| 1rr7A 1rr7_A NP_050621.1.92540 WP_000133853.1.10400 WP_000133853.1.12342 WP_000133853.1.13495 WP_000133853.1.15282 WP_000133853.1.23135 WP_000133853.1.29979 WP_000133853.1.43750 WP_000133853.1.63746 VMOR_BPMU gi|386708029|ref|YP_006171750.1| gi|386708029|ref|YP_006171750.1| gi|544392813|ref|YP_008563448.1| gi|9633507|ref|NP_050621.1| gi|378714363|ref|YP_005279256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]