SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ru8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ru8A
Domain Number 1 Region: 7-228
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.18e-76
Family N-type ATP pyrophosphatases 0.00000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ru8A   PDB: 1ru8   SUPERFAMILY: 1ru8A
Sequence length 232
Comment (A:)
Sequence
mvgladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqar
algiplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevy
tpawgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhv
ageggefetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh
Download sequence
Identical sequences 1ru8A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]