SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rypI from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rypI
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.84e-78
Family Proteasome subunits 0.000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rypI   PDB: 1ryp   SUPERFAMILY: 1rypI
Sequence length 222
Comment (I:)
Sequence
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Download sequence
Identical sequences 000007814|e1rypI1|210.1.1.4|I:1-222 000086876|e2zcyV1|210.1.1.4|V:1-222 000086877|e2gplH1|210.1.1.4|H:1-222 000086878|e1g0uH1|210.1.1.4|H:1-222 000086879|e1jd2H1|210.1.1.4|H:1-222 000086880|e3e47H1|210.1.1.4|H:1-222 000086882|e2gplV1|210.1.1.4|V:1-222 000086883|e1z7qW1|210.1.1.4|W:1-222 000086884|e1g65V1|210.1.1.4|V:1-222 000086885|e3bdmH1|210.1.1.4|H:1-222 000086886|e1rypW1|210.1.1.4|W:1-222 000086887|e3e47V1|210.1.1.4|V:1-222 000086888|e1z7qI1|210.1.1.4|I:1-222 000086889|e1g0uV1|210.1.1.4|V:1-222 000086890|e1jd2O1|210.1.1.4|O:1-222 000086891|e2f16V1|210.1.1.4|V:1-222 000086892|e3d29H1|210.1.1.4|H:1-222 000086893|e1g65H1|210.1.1.4|H:1-222 000086894|e3d29V1|210.1.1.4|V:1-222 000086895|e2f16H1|210.1.1.4|H:1-222 000086896|e2zcyH1|210.1.1.4|H:1-222 000086897|e3bdmV1|210.1.1.4|V:1-222 000086898|e2fakV1|210.1.1.4|V:1-222 000086899|e2fakH1|210.1.1.4|H:1-222 000142360|e3nzjH1|210.1.1.4|H:30-251 000148339|e3un4H1|210.1.1.4|H:1-222 000150611|e3sdiH1|210.1.1.4|H:1-222 000152308|e4gk7H1|210.1.1.4|H:1-222 000152371|e4b4t21|210.1.1.4|2:30-251 000152424|e4g4sI1|210.1.1.4|I:1-222 000153340|e4fzcH1|210.1.1.4|H:1-222 000181713|e3oeuH1|210.1.1.4|H:1-222 000222429|e4inrH1|210.1.1.4|H:1-222 000224772|e4j70H1|210.1.1.4|H:1-222 000351412|e3dy3H1|210.1.1.4|H:1-222 000351413|e3dy3V1|210.1.1.4|V:1-222 000351440|e3dy4H1|210.1.1.4|H:1-222 000351441|e3dy4V1|210.1.1.4|V:1-222 000364521|e3gpjH1|210.1.1.4|H:1-222 000364522|e3gpjV1|210.1.1.4|V:1-222 000372523|e3gptH1|210.1.1.4|H:1-222 000372524|e3gptV1|210.1.1.4|V:1-222 000372551|e3gpwH1|210.1.1.4|H:1-222 000372552|e3gpwV1|210.1.1.4|V:1-222 000372763|e3hyeH1|210.1.1.4|H:1-222 000372764|e3hyeV1|210.1.1.4|V:1-222 000393334|e3l5qM1|210.1.1.4|M:1-222 000393335|e3l5qY1|210.1.1.4|Y:1-222 000393764|e1vsyI1|210.1.1.4|I:1-222 000393765|e1vsyW1|210.1.1.4|W:1-222 000412852|e3nzjV1|210.1.1.4|V:30-251 000412879|e3nzwH1|210.1.1.4|H:30-251 000412880|e3nzwV1|210.1.1.4|V:30-251 000412907|e3nzxH1|210.1.1.4|H:30-251 000412908|e3nzxV1|210.1.1.4|V:30-251 000417813|e3mg4H1|210.1.1.4|H:1-222 000417814|e3mg4V1|210.1.1.4|V:1-222 000419340|e3mg0H1|210.1.1.4|H:1-222 000419341|e3mg0V1|210.1.1.4|V:1-222 000419368|e3mg6H1|210.1.1.4|H:1-222 000419369|e3mg6V1|210.1.1.4|V:1-222 000419396|e3mg7H1|210.1.1.4|H:1-222 000419397|e3mg7V1|210.1.1.4|V:1-222 000419424|e3mg8H1|210.1.1.4|H:1-222 000419425|e3mg8V1|210.1.1.4|V:1-222 000421315|e3okjH1|210.1.1.4|H:1-222 000421316|e3okjV1|210.1.1.4|V:1-222 000424412|e3oeuV1|210.1.1.4|V:1-222 000424439|e3oevH1|210.1.1.4|H:1-222 000424440|e3oevV1|210.1.1.4|V:1-222 000431042|e3tddH1|210.1.1.4|H:1-222 000431043|e3tddV1|210.1.1.4|V:1-222 000435251|e3shjH1|210.1.1.4|H:1-222 000435252|e3shjV1|210.1.1.4|V:1-222 000470430|e1fntI1|210.1.1.4|I:1-222 000470431|e1fntW1|210.1.1.4|W:1-222 000969526|e4intH1|210.1.1.4|H:1-222 000969527|e3un8V1|210.1.1.4|V:1-222 000969528|e4inrV1|210.1.1.4|V:1-222 000969529|e4inuH1|210.1.1.4|H:1-222 000969530|e4fzgH1|210.1.1.4|H:1-222 000969531|e3sdkH1|210.1.1.4|H:1-222 000969532|e3un8H1|210.1.1.4|H:1-222 000969533|e3un4V1|210.1.1.4|V:1-222 000969534|e3sdkV1|210.1.1.4|V:1-222 000969535|e4inuV1|210.1.1.4|V:1-222 000969536|e4fzcV1|210.1.1.4|V:1-222 000969537|e4gk7V1|210.1.1.4|V:1-222 000969538|e4j70V1|210.1.1.4|V:1-222 000969539|e3sdiV1|210.1.1.4|V:1-222 000969540|e4intV1|210.1.1.4|V:1-222 000969541|e4fzgV1|210.1.1.4|V:1-222 001014594|e4jt0V1|210.1.1.4|V:1-222 001014595|e4jt0H1|210.1.1.4|H:1-222 001014596|e4jsuV1|210.1.1.4|V:1-222 001014597|e4jsqV1|210.1.1.4|V:1-222 001014598|e4eu2I1|210.1.1.4|I:1-222 001014599|e4jsqH1|210.1.1.4|H:1-222 001014600|e4eu2W1|210.1.1.4|W:1-222 001014601|e4jsuH1|210.1.1.4|H:1-222 001125505|e4lqiH1|210.1.1.4|H:1-222 001126094|e4lqiV1|210.1.1.4|V:1-222 001140763|e4hnpH1|210.1.1.4|H:1-222 001142469|e4hnpV1|210.1.1.4|V:1-222 001142492|e4hrcH1|210.1.1.4|H:1-222 001142493|e4hrcV1|210.1.1.4|V:1-222 001142520|e4hrdH1|210.1.1.4|H:1-222 001142521|e4hrdV1|210.1.1.4|V:1-222 001144678|e4nnnH1|210.1.1.4|H:1-222 001281952|e4nnnV1|210.1.1.4|V:1-222 001281973|e4nnwH1|210.1.1.4|H:1-222 001281974|e4nnwV1|210.1.1.4|V:1-222 001281999|e4no1H1|210.1.1.4|H:1-222 001282000|e4no1V1|210.1.1.4|V:1-222 001282025|e4no6H1|210.1.1.4|H:1-222 001282026|e4no6V1|210.1.1.4|V:1-222 001282051|e4no8H1|210.1.1.4|H:1-222 001282052|e4no8V1|210.1.1.4|V:1-222 001282077|e4no9H1|210.1.1.4|H:1-222 001282078|e4no9V1|210.1.1.4|V:1-222 001299658|e4ltcH1|210.1.1.4|H:1-222 001299659|e4ltcV1|210.1.1.4|V:1-222 001316305|e4qlqV1|210.1.1.4|V:1-222 001316326|e4qlsH1|210.1.1.4|H:1-222 001316327|e4qlsV1|210.1.1.4|V:1-222 001316354|e4qltH1|210.1.1.4|H:1-222 001316355|e4qltV1|210.1.1.4|V:1-222 001316382|e4qluH1|210.1.1.4|H:1-222 001316383|e4qluV1|210.1.1.4|V:1-222 001316410|e4qlvH1|210.1.1.4|H:1-222 001316411|e4qlvV1|210.1.1.4|V:1-222 001317113|e4q1sH1|210.1.1.4|H:1-222 001317114|e4q1sV1|210.1.1.4|V:1-222 001318574|e4qlqH1|210.1.1.4|H:1-222 001401614|e3wxrI1|210.1.1.4|I:30-251 001401615|e3wxrW1|210.1.1.4|W:30-251 001438946|e4v7oAM1|210.1.1.4|AM:1-222 001438947|e4v7oAY1|210.1.1.4|AY:1-222 001438948|e4v7oBI1|210.1.1.4|BI:1-222 001438949|e4v7oBW1|210.1.1.4|BW:1-222 001496852|e4qw4H1|210.1.1.4|H:1-222 001496853|e4qw4V1|210.1.1.4|V:1-222 001496880|e4qw5H1|210.1.1.4|H:1-222 001496881|e4qw5V1|210.1.1.4|V:1-222 001496908|e4qw6H1|210.1.1.4|H:1-222 001496909|e4qw6V1|210.1.1.4|V:1-222 001496936|e4qw7H1|210.1.1.4|H:1-222 001496937|e4qw7V1|210.1.1.4|V:1-222 001496964|e4qwfH1|210.1.1.4|H:1-222 001496965|e4qwfV1|210.1.1.4|V:1-222 001496992|e4qwgH1|210.1.1.4|H:1-222 001496993|e4qwgV1|210.1.1.4|V:1-222 001497020|e4qwiH1|210.1.1.4|H:1-222 001497021|e4qwiV1|210.1.1.4|V:1-222 001497048|e4qwjH1|210.1.1.4|H:1-222 001497049|e4qwjV1|210.1.1.4|V:1-222 001497076|e4qwkH1|210.1.1.4|H:1-222 001497077|e4qwkV1|210.1.1.4|V:1-222 001497104|e4qwlH1|210.1.1.4|H:1-222 001497105|e4qwlV1|210.1.1.4|V:1-222 001497132|e4qwrH1|210.1.1.4|H:1-222 001497133|e4qwrV1|210.1.1.4|V:1-222 001497160|e4qwsH1|210.1.1.4|H:1-222 001497161|e4qwsV1|210.1.1.4|V:1-222 001497216|e4qwxH1|210.1.1.4|H:1-222 001497217|e4qwxV1|210.1.1.4|V:1-222 001497244|e4qxjH1|210.1.1.4|H:1-222 001497245|e4qxjV1|210.1.1.4|V:1-222 001497272|e4qz0H1|210.1.1.4|H:1-222 001497273|e4qz0V1|210.1.1.4|V:1-222 001497300|e4qz1H1|210.1.1.4|H:1-222 001497301|e4qz1V1|210.1.1.4|V:1-222 001497328|e4qz2H1|210.1.1.4|H:1-222 001497329|e4qz2V1|210.1.1.4|V:1-222 001497356|e4qz3H1|210.1.1.4|H:1-222 001497357|e4qz3V1|210.1.1.4|V:1-222 001497384|e4qz4H1|210.1.1.4|H:1-222 001497385|e4qz4V1|210.1.1.4|V:1-222 001497412|e4qz5H1|210.1.1.4|H:1-222 001497413|e4qz5V1|210.1.1.4|V:1-222 001497440|e4qz6H1|210.1.1.4|H:1-222 001497441|e4qz6V1|210.1.1.4|V:1-222 001497468|e4qz7H1|210.1.1.4|H:1-222 001497469|e4qz7V1|210.1.1.4|V:1-222 001497496|e4qzwH1|210.1.1.4|H:1-222 001497497|e4qzwV1|210.1.1.4|V:1-222 001497524|e4qzxH1|210.1.1.4|H:1-222 001497525|e4qzxV1|210.1.1.4|V:1-222 001498432|e5ahjH1|210.1.1.4|H:1-222 001500708|e5ahjV1|210.1.1.4|V:1-222 001561021|e4y6zH1|210.1.1.4|H:1-222 001561022|e4y6zV1|210.1.1.4|V:1-222 001561049|e4y70H1|210.1.1.4|H:1-222 001561050|e4y70V1|210.1.1.4|V:1-222 001561077|e4y74H1|210.1.1.4|H:1-222 001561078|e4y74V1|210.1.1.4|V:1-222 001561105|e4y75H1|210.1.1.4|H:1-222 001561106|e4y75V1|210.1.1.4|V:1-222 001561133|e4y77H1|210.1.1.4|H:1-222 001561134|e4y77V1|210.1.1.4|V:1-222 001561161|e4y78H1|210.1.1.4|H:1-222 001561162|e4y78V1|210.1.1.4|V:1-222 001561189|e4y7wH1|210.1.1.4|H:1-222 001561190|e4y7wV1|210.1.1.4|V:1-222 001561217|e4y7xH1|210.1.1.4|H:1-222 001561218|e4y7xV1|210.1.1.4|V:1-222 001561245|e4y7yH1|210.1.1.4|H:1-222 001561246|e4y7yV1|210.1.1.4|V:1-222 001561273|e4y80H1|210.1.1.4|H:1-222 001561274|e4y80V1|210.1.1.4|V:1-222 001561301|e4y81H1|210.1.1.4|H:1-222 001561302|e4y81V1|210.1.1.4|V:1-222 001561329|e4y82H1|210.1.1.4|H:1-222 001561330|e4y82V1|210.1.1.4|V:1-222 001561357|e4y84H1|210.1.1.4|H:1-222 001561358|e4y84V1|210.1.1.4|V:1-222 001561385|e4y8gH1|210.1.1.4|H:1-222 001561386|e4y8gV1|210.1.1.4|V:1-222 001561413|e4y8hH1|210.1.1.4|H:1-222 001561414|e4y8hV1|210.1.1.4|V:1-222 001561441|e4y8iH1|210.1.1.4|H:1-222 001561442|e4y8iV1|210.1.1.4|V:1-222 001561469|e4y8jH1|210.1.1.4|H:1-222 001561470|e4y8jV1|210.1.1.4|V:1-222 001561497|e4y8kH1|210.1.1.4|H:1-222 001561498|e4y8kV1|210.1.1.4|V:1-222 001561525|e4y8lH1|210.1.1.4|H:1-222 001561526|e4y8lV1|210.1.1.4|V:1-222 001561609|e4y8oH1|210.1.1.4|H:1-222 001561610|e4y8oV1|210.1.1.4|V:1-222 001561637|e4y8pH1|210.1.1.4|H:1-222 001561638|e4y8pV1|210.1.1.4|V:1-222 001561665|e4y8qH1|210.1.1.4|H:1-222 001561666|e4y8qV1|210.1.1.4|V:1-222 001714842|e5cggH1|210.1.1.4|H:1-222 001714843|e5cggV1|210.1.1.4|V:1-222 001714870|e5cgiH1|210.1.1.4|H:1-222 001714871|e5cgiV1|210.1.1.4|V:1-222 001715933|e5cghH1|210.1.1.4|H:1-222 001715934|e5cghV1|210.1.1.4|V:1-222 001790479|e5cz5H1|210.1.1.4|H:1-222 001790480|e5cz5V1|210.1.1.4|V:1-222 001790563|e5cz8H1|210.1.1.4|H:1-222 001790564|e5cz8V1|210.1.1.4|V:1-222 001790591|e5cz9H1|210.1.1.4|H:1-222 001790592|e5cz9V1|210.1.1.4|V:1-222 001790647|e5d0sH1|210.1.1.4|H:1-222 001790648|e5d0sV1|210.1.1.4|V:1-222 001790703|e5d0vH1|210.1.1.4|H:1-222 001790704|e5d0vV1|210.1.1.4|V:1-222 001790787|e5d0zH1|210.1.1.4|H:1-222 001790788|e5d0zV1|210.1.1.4|V:1-222 001791019|e5fgdH1|210.1.1.4|H:1-222 001791020|e5fgdV1|210.1.1.4|V:1-222 001791047|e5fgeH1|210.1.1.4|H:1-222 001791048|e5fgeV1|210.1.1.4|V:1-222 001791075|e5fgfH1|210.1.1.4|H:1-222 001791076|e5fgfV1|210.1.1.4|V:1-222 001791103|e5fggH1|210.1.1.4|H:1-222 001791104|e5fggV1|210.1.1.4|V:1-222 001791187|e5fhsH1|210.1.1.4|H:1-222 001791188|e5fhsV1|210.1.1.4|V:1-222 001840034|e4zzgI1|210.1.1.4|I:30-251 001840035|e4zzgW1|210.1.1.4|W:30-251 001842366|e3jco41|210.1.1.4|4:30-251 001842367|e3jcoi1|210.1.1.4|i:30-251 001842429|e3jcp41|210.1.1.4|4:30-251 001842430|e3jcpi1|210.1.1.4|i:30-251 001869491|e5jhrH1|210.1.1.4|H:1-222 001869492|e5jhrV1|210.1.1.4|V:1-222 001869516|e5jhsH1|210.1.1.4|H:1-222 001869517|e5jhsV1|210.1.1.4|V:1-222 001917309|e5l52H1|210.1.1.4|H:1-222 001917310|e5l52V1|210.1.1.4|V:1-222 001917337|e5l54H1|210.1.1.4|H:1-222 001917338|e5l54V1|210.1.1.4|V:1-222 001917365|e5l55H1|210.1.1.4|H:1-222 001917366|e5l55V1|210.1.1.4|V:1-222 002047273|e5wvii1|210.1.1.4|i:30-251 002047274|e5wvi21|210.1.1.4|2:30-251 002097826|e5nifI1|210.1.1.4|I:30-251 002097827|e5nifW1|210.1.1.4|W:30-251 cath|current|1g0uH00/1-223 cath|current|1g0uV00/1-223 cath|current|1g65H00/1-223 cath|current|1g65V00/1-223 cath|current|1jd2H00/1-223 cath|current|1jd2O00/1-223 cath|current|1rypI00/1-222 cath|current|1rypW00/1-222 cath|current|1vsyI00/2001-2222 cath|current|1vsyW00/2001-2222 cath|current|1z7qI00/1-222 cath|current|1z7qW00/1-222 cath|current|2f16H00/1-223 cath|current|2f16V00/1-223 cath|current|2fakH00/1-223 cath|current|2fakV00/1-223 cath|current|2fnyH00/1-223 cath|current|2fnyV00/1-223 cath|current|2gplH00/1-223 cath|current|2gplV00/1-223 cath|current|3d29H00/1-223 cath|current|3d29V00/1-223 cath|current|3dy3H00/1-223 cath|current|3dy3V00/1-223 cath|current|3dy4H00/1-223 cath|current|3dy4V00/1-223 cath|current|3e47H00/1-223 cath|current|3e47V00/1-223 cath|current|3gpjH00/1-223 cath|current|3gpjV00/1-223 cath|current|3gptH00/1-223 cath|current|3gptV00/1-223 cath|current|3gpwH00/1-223 cath|current|3gpwV00/1-223 cath|current|3hyeH00/1-223 cath|current|3hyeV00/1-223 cath|current|3l5qM00/2001-2222 cath|current|3l5qY00/2001-2222 cath|current|3mg0H00/1-223 cath|current|3mg0V00/1-223 cath|current|3mg4H00/1-223 cath|current|3mg4V00/1-223 cath|current|3mg6H00/1-223 cath|current|3mg6V00/1-223 cath|current|3mg7H00/1-223 cath|current|3mg7V00/1-223 cath|current|3mg8H00/1-223 cath|current|3mg8V00/1-223 cath|current|3oeuH00/1-223 cath|current|3oeuV00/1-223 cath|current|3oevH00/1-223 cath|current|3oevV00/1-223 cath|current|3okjH00/1-223 cath|current|3okjV00/1-223 cath|current|3sdiH00/1-223 cath|current|3sdiV00/1-223 cath|current|3sdkH00/1-223 cath|current|3sdkV00/1-223 cath|current|3shjH00/1-223 cath|current|3shjV00/1-223 cath|current|3tddH00/1-223 cath|current|3tddV00/1-223 cath|current|4eu2I00/1-222 cath|current|4eu2W00/1-222 cath|current|4fzcH00/1-222 cath|current|4fzcV00/1-222 cath|current|4fzgH00/1-222 cath|current|4fzgV00/1-222 cath|current|4gk7H00/1-222 cath|current|4gk7V00/1-222 cath|current|4hnpH00/1-222 cath|current|4hnpV00/1-222 cath|current|4hrcH00/1-222 cath|current|4hrcV00/1-222 cath|current|4hrdH00/1-222 cath|current|4hrdV00/1-222 cath|current|4lqiH00/1-223 cath|current|4lqiV00/1-223 d1g0uh_ d1g0uv_ d1g65h_ d1g65v_ d1jd2h_ d1jd2o_ d1rypi_ d1rypw_ d1vsyi_ d1vsyw_ d1z7qi1 d1z7qw1 d2f16h_ d2f16v_ d2fakh_ d2fakv_ d2fnyh_ d2fnyv_ d2gplh_ d2gplv_ d2zcyh_ d2zcyv_ d3bdmh_ d3bdmv_ d3d29h_ d3d29v_ d3dy3h_ d3dy3v_ d3dy4h_ d3dy4v_ d3e47h_ d3e47v_ d3gpjh_ d3gpjv_ d3gpth_ d3gptv_ d3gpwh_ d3gpwv_ d3hyeh_ d3hyev_ d3l5qm_ d3l5qy_ d3mg0h_ d3mg0v_ d3mg4h_ d3mg4v_ d3mg6h_ d3mg6v_ d3mg7h_ d3mg7v_ d3mg8h_ d3mg8v_ d3nzjh_ d3nzjv_ d3nzwh_ d3nzwv_ d3nzxh_ d3nzxv_ d3oeuh_ d3oeuv_ d3oevh_ d3oevv_ d3okjh_ d3okjv_ d3sdih_ d3sdiv_ d3sdkh_ d3sdkv_ d3shjh_ d3shjv_ d3tddh_ d3tddv_ d3un8h_ d3un8v_ d3wxri_ d3wxrw_ d4eu2i_ d4eu2w_ d4fzch_ d4fzcv_ d4fzgh_ d4fzgv_ d4hnph_ d4hnpv_ d4hrch_ d4hrcv_ d4hrdh_ d4hrdv_ d4inrh_ d4inrv_ d4inth_ d4intv_ d4inuh_ d4inuv_ d4j70h_ d4j70v_ d4jsqh_ d4jsqv_ d4jsuh_ d4jsuv_ d4jt0h_ d4jt0v_ d4lqih_ d4lqiv_ d4ltch_ d4ltcv_ d4nnnh_ d4nnnv_ d4nnwh_ d4nnwv_ d4no1h_ d4no1v_ d4no6h_ d4no6v_ d4no8h_ d4no8v_ d4no9h_ d4no9v_ d4q1sh_ d4q1sv_ d4qlqh_ d4qlqv_ d4qlsh_ d4qlsv_ d4qlth_ d4qltv_ d4qluh_ d4qluv_ d4qlvh_ d4qlvv_ d4qw4h_ d4qw4v_ d4qw5h_ d4qw5v_ d4qw6h_ d4qw6v_ d4qw7h_ d4qw7v_ d4qwfh_ d4qwfv_ d4qwgh_ d4qwgv_ d4qwih_ d4qwiv_ d4qwjh_ d4qwjv_ d4qwkh_ d4qwkv_ d4qwlh_ d4qwlv_ d4qwrh_ d4qwrv_ d4qwsh_ d4qwsv_ d4qwxh_ d4qwxv_ d4qxjh_ d4qxjv_ d4qz0h_ d4qz0v_ d4qz1h_ d4qz1v_ d4qz2h_ d4qz2v_ d4qz3h_ d4qz3v_ d4qz4h_ d4qz4v_ d4qz5h_ d4qz5v_ d4qz6h_ d4qz6v_ d4qz7h_ d4qz7v_ d4qzwh_ d4qzwv_ d4qzxh_ d4qzxv_ d5ahjh_ d5ahjv_ d5cz5h_ d5cz5v_ d5cz8h_ d5cz8v_ d5cz9h_ d5cz9v_ d5d0sh_ d5d0sv_ d5d0vh_ d5d0vv_ d5d0zh_ d5d0zv_ d5fgdh_ d5fgdv_ d5fgeh_ d5fgev_ d5fgfh_ d5fgfv_ d5fggh_ d5fggv_ d5fhsh_ d5fhsv_ d5jhrh_ d5jhrv_ d5jhsh_ d5jhsv_ d5l52h_ d5l52v_ d5l54h_ d5l54v_ d5l55h_ d5l55v_ 1g0u_H 1g0u_V 1g65_H 1g65_V 1jd2_H 1jd2_O 1ryp_I 1ryp_W 1z7q_I 1z7q_W 2f16_H 2f16_V 2fak_H 2fak_V 2gpl_H 2gpl_V 3d29_H 3d29_V 3dy3_H 3dy3_V 3dy4_H 3dy4_V 3e47_H 3e47_V 3gpj_H 3gpj_V 3gpt_H 3gpt_V 3gpw_H 3gpw_V 3hye_H 3hye_V 3mg0_H 3mg0_V 3mg4_H 3mg4_V 3mg6_H 3mg6_V 3mg7_H 3mg7_V 3mg8_H 3mg8_V 3oeu_H 3oeu_V 3oev_H 3oev_V 3okj_H 3okj_V 3sdi_H 3sdi_V 3sdk_H 3sdk_V 3shj_H 3shj_V 3tdd_H 3tdd_V 4eu2_I 4eu2_W 4fzc_H 4fzc_V 4fzg_H 4fzg_V 4gk7_H 4gk7_V 4hnp_H 4hnp_V 4hrc_H 4hrc_V 4hrd_H 4hrd_V 4lqi_H 4lqi_V 4v7o_AM 4v7o_AY 4v7o_BI 4v7o_BW 1rypI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]