SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rztA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rztA
Domain Number 1 Region: 146-330
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.1e-82
Family DNA polymerase beta-like 0.000000504
Further Details:      
 
Domain Number 2 Region: 5-83
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 4.69e-34
Family DNA polymerase beta, N-terminal domain-like 0.0000538
Further Details:      
 
Domain Number 3 Region: 86-140
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 6.13e-18
Family DNA polymerase beta-like, second domain 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1rztA   PDB: 1rzt
Sequence length 331
Comment (A:)
Sequence
ssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipg
igkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledir
sqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkat
cgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgr
rhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgck
vgpgrvlptptekdvfrllglpyrepaerdw
Download sequence
Identical sequences 1rztA 1rzt_A 1rzt_E 1rzt_I 1rzt_M

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]