SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1s2jA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1s2jA
Domain Number 1 Region: 37-203
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 6.3e-62
Family N-acetylmuramoyl-L-alanine amidase-like 0.000000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1s2jA   PDB: 1s2j   SUPERFAMILY: 1s2jA
Sequence length 209
Comment (A:)
Sequence
mqpvrfgspwimaiglvllllafvsagksrqrspancptiklkrqwggkpslglhyqvrp
iryvvihhtvtgecsgllkcaeilqnmqayhqneldfndisynfligndgivyegtgwgl
rgahtygynaigtgiafignfvdklpsdaalqaakdllacgvqqgelsedyaliagsqvi
stqspgltlyneiqewphwlsnphhhhhh
Download sequence
Identical sequences 1s2jA 1s2j_A 1s2j_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]