SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1s3aA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1s3aA
Domain Number 1 Region: 19-100
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.43e-25
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.00000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1s3aA   PDB: 1s3a
Sequence length 102
Comment (A:)
Sequence
kagmaaaaasrgvgaklglreirihlcqrspgsqgvrdfiekryvelkkanpdlpilire
csdvqpklwaryafgqetnvplnnfsadqvtralenvlsgka
Download sequence
Identical sequences 1s3aA 1s3a_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]