SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1s4dA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1s4dA
Domain Number 1 Region: 14-252
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 2.12e-131
Family Tetrapyrrole methylase 0.000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1s4dA   PDB: 1s4d   SUPERFAMILY: 1s4dA
Sequence length 280
Comment (A:)
Sequence
MIDDLFAGLPALEKGSVWLVGAGPGDPGLLTLHAANALRQADVIVHDALVNEDCLKLARP
GAVLEFAGKRGGKPSPKQRDISLRLVELARAGNRVLRLKGGDPFVFGRGGEEALTLVEHQ
VPFRIVPGITAGIGGLAYAGIPVTHREVNHAVTFLTGHDSSGLVPDRINWQGIASGSPVI
VMYMAMKHIGAITANLIAGGRSPDEPVAFVCNAATPQQAVLETTLARAEADVAAAGLEPP
AIVVVGEVVRLRAALDWIGALDGRKLAADPFANRILRNPA
Download sequence
Identical sequences A0A0T6XTC5 A0A1G9I1X7 I0FXH1 P21631
1s4d_A 1s4d_B 1s4d_D 1s4d_E 1s4d_F 1s4d_G 1s4d_H 1s4d_I 1s4d_J 1s4d_K 1s4d_L 1s4d_M 1s4dA WP_034788292.1.19033 WP_034788292.1.4016 WP_034788292.1.45764 WP_034788292.1.80080 WP_034788292.1.88016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]