SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1s98A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1s98A
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily HesB-like domain 5.78e-62
Family HesB-like domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1s98A   PDB: 1s98   SUPERFAMILY: 1s98A
Sequence length 107
Comment (A:)
Sequence
msitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgv
kvvvdgksmqfldgtqldfvkeglnegfkftnpnvkdecgcgesfhv
Download sequence
Identical sequences 1s98A cath|current|1s98A00/2-98 cath|current|1s98B00/2-98 1s98_A 1s98_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]