SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1sa0E from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1sa0E
Domain Number 1 Region: 2-137
Classification Level Classification E-value
Superfamily Stathmin 1.61e-57
Family Stathmin 0.000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1sa0E   PDB: 1sa0   SUPERFAMILY: 1sa0E
Sequence length 142
Comment (E:)
Sequence
admevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
qekdkhaeevrknkelkeeasr
Download sequence
Identical sequences 1sa0_E 1sa1_E 1z2b_E 3du7_E 3e22_E 3hkb_E 3hkc_E 3hkd_E 3hke_E 3n2g_E 3n2k_E 1sa0E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]