SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1sa1E from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1sa1E
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Stathmin 1.57e-57
Family Stathmin 0.000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1sa1E   PDB: 1sa1   SUPERFAMILY: 1sa1E
Sequence length 143
Comment (E:)
Sequence
xadmevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrk
yqeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamler
lqekdkhaeevrknkelkeeasr
Download sequence
Identical sequences 1sa1E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]