SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1sanA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1sanA
Domain Number 1 Region: 2-53
Classification Level Classification E-value
Superfamily Homeodomain-like 9.09e-35
Family Homeodomain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1sanA   PDB: 1san   SUPERFAMILY: 1sanA
Sequence length 62
Comment (A:)
Sequence
mtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkkenktkge
pg
Download sequence
Identical sequences 001160051|e1sanA2|101.1.1.10|A:1-62 cath|current|1sanA00/6-67 d1sana_ 1sanA 1san_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]